PDB entry 1vzx

View 1vzx on RCSB PDB site
Description: roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase
Class: transferase
Keywords: transferase, alpha-1, 3-galactosyltransferase-udp complex, glycosyltransferase, glycoprotein, transmembrane
Deposited on 2004-05-28, released 2004-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.1543
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769
      • engineered mutation (234)
    Domains in SCOPe 2.07: d1vzxa_
  • Chain 'B':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769 (Start-288)
      • engineered mutation (234)
    Domains in SCOPe 2.07: d1vzxb_
  • Heterogens: MN, UDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzxA (A:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzxA (A:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vzxB (B:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzxB (B:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv