PDB entry 1vzv

View 1vzv on RCSB PDB site
Description: structure of varicella-zoster virus protease
Class: serine protease
Keywords: hydrolase, serine protease, viral protease, varicella-zoster virus, coat protein
Deposited on 1997-02-10, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: varicella-zoster virus protease
    Species: Human herpesvirus 3 [TaxId:10335]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vzva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzvA (A:)
    ealyvagylalyskdegelnitpeivrsalpptskipinidhrkdcvvgeviaiiedirg
    pfflgivrcpqlhavlfeaahsnffgnrdsvlspleralylvtnylpsvslsskrlspne
    ipdgnffthvalcvvgrrvgtvvnydctpessiepfrvlsmeskarllslvkdyaglnkv
    wkvsedklakvllstavnnmllrdrwdvvakrrreagimgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzvA (A:)
    ealyvagylalyskdegelnitpeivrsalpptskipinidhrkdcvvgeviaiiedirg
    pfflgivrcpqlhavlfeaahsnffgnrdsvlspleralylvtnylpsvslsskrlfthv
    alcvvgrrvgtvvnydctpessiepfrvlsmeskarllslvkdyaglnkvwkvsedklak
    vllstavnnmllrdrwdvvakrrreagimgh