PDB entry 1vzt

View 1vzt on RCSB PDB site
Description: roles on individual residues of alpha-1,3 galactosyltransferases in substrate binding and catalysis
Class: transferase
Keywords: transferase, alpha-1, 3-galactosyltransferase-udp complex, glycosyltransferase, glycoprotein, transmembrane, nucleotide-binding protein, xenotransplantation
Deposited on 2004-05-26, released 2005-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769
      • engineered mutation (169)
    Domains in SCOPe 2.07: d1vzta_
  • Chain 'B':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769 (Start-288)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d1vztb_
  • Heterogens: MN, UDP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vztA (A:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqagwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vztA (A:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqagwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vztB (B:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqagwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vztB (B:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqagwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv