PDB entry 1vzs

View 1vzs on RCSB PDB site
Description: Solution structure of subunit F6 from the peripheral stalk region of ATP synthase from bovine heart mitochondria
Class: synthase
Keywords: synthase, ATP synthase, peripheral stalk, f6 subunit, hydrogen ion transport
Deposited on 2004-05-25, released 2004-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP synthase coupling factor 6, mitochondrial precursor
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02721 (0-75)
  Domains in SCOPe 2.08: d1vzsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vzsA (A:)
  nkeldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpn
  ftfedpkfevvekpqs