PDB entry 1vzr

View 1vzr on RCSB PDB site
Description: solution structure of at4g04830
Deposited on 2004-05-24, released 2004-10-01
The last revision was dated 2004-10-14, with a file datestamp of 2007-06-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4b21.5 protein
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vzrA (A:)
    maasplvvqkteeewravlspeqfrilrqkgtekpgtgeydkffeegifdcvgcktplyk
    sttkfdsgcgwpaffeglpgainrtpdpdgrrteitcaacdghlghvfkgegygnptder
    hcvnsvsisfnpaksssii
    

    Sequence, based on observed residues (ATOM records):
    >1vzrA (A:)
    aasplvvqkteeewravlspeqfrilrqkgtekpgtgeydkffeegifdcvgcktplyks
    ttkfdsgcgwpaffeglpgainrtpdpdgrrteitcaacdghlghvfkgegygnptderh
    cvnsvsisfnpaksssii