PDB entry 1vzq

View 1vzq on RCSB PDB site
Description: complex of thrombin with designed inhibitor 7165
Deposited on 2004-05-24, released 2005-06-20
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: thrombin heavy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Hirudin variant-2
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: thrombin light
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SHY, NA, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1vzqH (H:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtayerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
    kwiqkvidqf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vzqI (I:)
    dfeeipeeylq
    

    Sequence, based on observed residues (ATOM records):
    >1vzqI (I:)
    dfeeipe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1vzqL (L:)
    adcglrplfekksledkterellesyi