PDB entry 1vzo

View 1vzo on RCSB PDB site
Description: the structure of the n-terminal kinase domain of msk1 reveals a novel autoinhibitory conformation for a dual kinase protein
Class: transferase
Keywords: protein kinase, transferase, phosphorylation, serine/threonine protein kinase
Deposited on 2004-05-21, released 2004-06-11
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2082
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6 kinase alpha 5
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vzoa_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzoA (A:)
    mahhhhhheeeggssggaagtsadggdggeqlltvkhelrtanltghaekvgienfellk
    vlgtgaygkvflvrkisghdtgklyamkvlkkativqkakttehtrterqvlehirqspf
    lvtlhyafqtetklhlildyinggelfthlsqrerftehevqiyvgeivlalehlhklgi
    iyrdiklenilldsnghvvltdfglskefvadeteraydfcgtieymapdivrggdsghd
    kavdwwslgvlmyelltgaspftvdgeknsqaeisrrilkseppypqemsalakdliqrl
    lmkdpkkrlgcgprdadeikehlffqkinwddlaakkvpapfkpvirdeldvsnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzoA (A:)
    qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl
    kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl
    sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv
    adeteraydfcgtieymapdivrggddkavdwwslgvlmyelltgaspftvdgeknsqae
    isrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinwddl
    aakkvpapfkpvirdeldv