PDB entry 1vzm

View 1vzm on RCSB PDB site
Description: osteocalcin from fish argyrosomus regius
Class: calcium-binding protein
Keywords: calcium-binding protein, osteocalcin, bone gla protein, bgp, hydroxyapatite, gamma carboxyl glutamic acid, vitamin k, bone, mineralization
Deposited on 2004-05-21, released 2004-09-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1916
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osteocalcin
    Species: ARGYROSOMUS REGIUS [TaxId:172269]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vzma_
  • Chain 'B':
    Compound: Osteocalcin
    Species: ARGYROSOMUS REGIUS [TaxId:172269]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vzmb_
  • Chain 'C':
    Compound: Osteocalcin
    Species: ARGYROSOMUS REGIUS [TaxId:172269]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vzmc_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzmA (A:)
    aakeltlaqteslrevcetnmacdemadaqgivaayqafygpipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzmA (A:)
    keltlaqteslrevcetnmacdemadaqgivaayqafygpipf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vzmB (B:)
    aakeltlaqteslrevcetnmacdemadaqgivaayqafygpipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzmB (B:)
    eltlaqteslrevcetnmacdemadaqgivaayqafygpipf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vzmC (C:)
    aakeltlaqteslrevcetnmacdemadaqgivaayqafygpipf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzmC (C:)
    ltlaqteslrevcetnmacdemadaqgivaayqafygpipf