PDB entry 1vzj

View 1vzj on RCSB PDB site
Description: structure of the tetramerization domain of acetylcholinesterase: four- fold interaction of a www motif with a left-handed polyproline helix
Deposited on 2004-05-20, released 2005-01-10
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.247
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: acetylcholinesterase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: acetylcholinesterase collagenic tail peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: acetylcholinesterase collagenic tail peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vzjA (A:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjA (A:)
    ldeaerqwkaefhrwssymvhwknqf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vzjB (B:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjB (B:)
    dtldeaerqwkaefhrwssymvhwknqfdhy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vzjC (C:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjC (C:)
    dtldeaerqwkaefhrwssymvhwknqfdhys
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vzjD (D:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjD (D:)
    dtldeaerqwkaefhrwssymvhwknqfdhys
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vzjE (E:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjE (E:)
    tldeaerqwkaefhrwssymvhwknqf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vzjF (F:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjF (F:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vzjG (G:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjG (G:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskq
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vzjH (H:)
    dtldeaerqwkaefhrwssymvhwknqfdhyskqdrcsdl
    

    Sequence, based on observed residues (ATOM records):
    >1vzjH (H:)
    dtldeaerqwkaefhrwssymvhwknqfdhys
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vzjI (I:)
    lltppppplfpppff
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1vzjJ (J:)
    lltppppplfpppff