PDB entry 1vzi

View 1vzi on RCSB PDB site
Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
Deposited on 2004-05-19, released 2004-08-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-27, with a file datestamp of 2004-08-27.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.1427
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vziA (A:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vziA (A:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vziB (B:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vziB (B:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen