PDB entry 1vzi

View 1vzi on RCSB PDB site
Description: Structure of superoxide reductase bound to ferrocyanide and active site expansion upon X-ray induced photoreduction
Class: oxidoreductase
Keywords: ferrocyanide, microspectrophotometry, redox states, photoreduction, dinuclear iron cluster, oxidoreductase, electron transport
Deposited on 2004-05-19, released 2004-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.1500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulfoferrodoxin
    Species: DESULFOVIBRIO BAARSII [TaxId:453230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46495 (Start-125)
      • engineered mutation (46)
    Domains in SCOPe 2.08: d1vzia1, d1vzia2
  • Chain 'B':
    Compound: desulfoferrodoxin
    Species: DESULFOVIBRIO BAARSII [TaxId:453230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46495 (Start-125)
      • engineered mutation (46)
    Domains in SCOPe 2.08: d1vzib1, d1vzib2
  • Heterogens: CA, CL, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vziA (A:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vziA (A:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vziB (B:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vziB (B:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen