PDB entry 1vzh

View 1vzh on RCSB PDB site
Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
Class: oxidoreductase
Keywords: ferrocyanide, microspectrophotometry, redox states, photoreduction, dinuclear iron cluster, oxidoreductase, electron transport
Deposited on 2004-05-19, released 2004-08-27
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.207
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulfoferrodoxin
    Species: Desulfoarculus baarsii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46495 (Start-125)
      • engineered mutation (46)
    Domains in SCOP 1.75: d1vzha1, d1vzha2
  • Chain 'B':
    Compound: desulfoferrodoxin
    Species: Desulfoarculus baarsii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46495 (Start-125)
      • engineered mutation (46)
    Domains in SCOP 1.75: d1vzhb1, d1vzhb2
  • Heterogens: FE, CA, FC6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzhA (A:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzhA (A:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vzhB (B:)
    mperlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggy
    kvkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihg
    hwkaen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzhB (B:)
    perlqvykcevcgnivevlnggigelvccnqdmklmsentvdaakakhvpviekidggyk
    vkvgavahpmeekhyiqwielladdkcytqflkpgqapeavflieaakvvareycnihgh
    wkaen