PDB entry 1vzd

View 1vzd on RCSB PDB site
Description: l. casei thymidylate synthase mutant e60q ternary complex with fdump and cb3717
Class: methyltransferase
Keywords: methyltransferase, nucleotide synthase
Deposited on 1996-09-18, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: THYMIDYLATE SYNTHASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (59)
      • conflict (110)
    Domains in SCOPe 2.08: d1vzda_
  • Heterogens: UFP, CB3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vzdA (A:)
    mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfgliksq
    llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkapefaavyhe
    emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
    ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
    ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
    llnydpypaikapvav