PDB entry 1vzb

View 1vzb on RCSB PDB site
Description: l. casei thymidylate synthase mutant e60q binary complex with dump
Class: methyltransferase
Keywords: methyltransferase, nucleotide synthase
Deposited on 1996-09-18, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: THYMIDYLATE SYNTHASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (59)
      • conflict (110)
    Domains in SCOPe 2.07: d1vzba_
  • Heterogens: UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vzbA (A:)
    mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfgliksq
    llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkapefaavyhe
    emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
    ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
    ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
    llnydpypaikapvav