PDB entry 1vz8

View 1vz8 on RCSB PDB site
Description: ornithine acetyltransferase (orf6 gene product - clavulanic acid biosynthesis) from streptomyces clavuligerus (semet structure)
Class: transferase
Keywords: transferase, ornithine acetyltransferase, clavulanic acid, n-acetyl- ornithine, n-acetyl-glutamate, antibiotic
Deposited on 2004-05-14, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.235
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine acetyl-transferase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz8a_
  • Chain 'B':
    Compound: ornithine acetyl-transferase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz8b_
  • Chain 'C':
    Compound: ornithine acetyl-transferase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz8c_
  • Chain 'D':
    Compound: ornithine acetyl-transferase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz8d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vz8A (A:)
    msdstpktprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcrea
    vadgqargvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypm
    esirehlktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdma
    tlltffatdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagef
    eealhtaalalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcd
    pnwgrvamaigkcsddtdidqervtirfgevevyppkargdqaddalraavaehlrgdev
    vigidlaiadgaftvygcdltegyvrlnseytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz8A (A:)
    tprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcreavadgqar
    gvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehl
    ktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffa
    tdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhta
    alalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrva
    maigkcsddtdidqervtirfgevevyppddalraavaehlrgdevvigidlaiadgaft
    vygcdltegyvrlnse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vz8B (B:)
    msdstpktprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcrea
    vadgqargvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypm
    esirehlktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdma
    tlltffatdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagef
    eealhtaalalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcd
    pnwgrvamaigkcsddtdidqervtirfgevevyppkargdqaddalraavaehlrgdev
    vigidlaiadgaftvygcdltegyvrlnseytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz8B (B:)
    tprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcreavadgqar
    gvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehl
    ktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffa
    tdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhta
    alalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrva
    maigkcsddtdidqervtirfgevevyppddalraavaehlrgdevvigidlaiadgaft
    vygcdltegyvrlnseytt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vz8C (C:)
    msdstpktprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcrea
    vadgqargvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypm
    esirehlktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdma
    tlltffatdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagef
    eealhtaalalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcd
    pnwgrvamaigkcsddtdidqervtirfgevevyppkargdqaddalraavaehlrgdev
    vigidlaiadgaftvygcdltegyvrlnseytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz8C (C:)
    tprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcreavadgqar
    gvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehl
    ktlefdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffatdarldp
    aeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhtaalalvkd
    iasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrvamaigkcs
    ddtdidqervtirfgevevyppddalraavaehlrgdevvigidlaiadgaftvygcdlt
    egyvrlnseytt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vz8D (D:)
    msdstpktprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcrea
    vadgqargvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypm
    esirehlktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdma
    tlltffatdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagef
    eealhtaalalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcd
    pnwgrvamaigkcsddtdidqervtirfgevevyppkargdqaddalraavaehlrgdev
    vigidlaiadgaftvygcdltegyvrlnseytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz8D (D:)
    tprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcreavadgqar
    gvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehl
    ktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffa
    tdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhta
    alalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrva
    maigkcsddtdidqervtirfgevevyppddalraavaehlrgdevvigidlaiadgaft
    vygcdltegyvrlnse