PDB entry 1vz5

View 1vz5 on RCSB PDB site
Description: succinate complex of atsk
Class: oxidoreductase
Keywords: non-heme fe(II) alphaketoglutarate dependent dioxygenase, alkylsulfatase, jelly roll, oxidoreductase, sulfatase, self hydroxylation
Deposited on 2004-05-14, released 2004-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz5a_
  • Chain 'B':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz5b_
  • Chain 'C':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz5c_
  • Chain 'D':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vz5d_
  • Heterogens: SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vz5A (A:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz5A (A:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvapvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwanta
    aayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslad
    sqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagev
    pvgvdgqlsrttrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vz5B (B:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz5B (B:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvapvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwanta
    aayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslad
    sqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagev
    pvgvdgqlsrttrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vz5C (C:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz5C (C:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvryllqlranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpe
    plreladklwavhsneyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlq
    ghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqls
    rttr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vz5D (D:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vz5D (D:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvtryllqldanswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelp
    eplreladklwavhsnyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlq
    ghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqls
    rttr