PDB entry 1vz3

View 1vz3 on RCSB PDB site
Description: prolyl oligopeptidase from porcine brain, t597c mutant
Deposited on 2004-05-14, released 2004-07-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-01, with a file datestamp of 2004-07-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vz3A (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawtcdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip