PDB entry 1vyy

View 1vyy on RCSB PDB site
Description: ralstonia solanacearum high-affinity mannose-binding lectin at 1.0a resolution in complex with d-mannose
Class: lectin
Keywords: lectin, sugar-binding protein, d-mannose, plant pathogen
Deposited on 2004-05-07, released 2005-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-05-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.103
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: RALSTONIA SOLANACEARUM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyya_
  • Heterogens: CA, UNK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyyA (A:)
    aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
    aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg