PDB entry 1vyx

View 1vyx on RCSB PDB site
Description: solution structure of the kshv k3 n-terminal domain
Class: zinc-binding protein
Keywords: zinc-binding protein, ring domain, cross-brace motif
Deposited on 2004-05-07, released 2004-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf k3
    Species: HUMAN HERPESVIRUS 8 [TaxId:37296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyxa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyxA (A:)
    mededvpvcwicneelgnerfracgctgelenvhrsclstwltisrntacqicgvvyntr