PDB entry 1vyx

View 1vyx on RCSB PDB site
Description: Solution structure of the KSHV K3 N-terminal domain
Class: zinc-binding protein
Keywords: zinc-binding protein, ring domain, cross-brace motif
Deposited on 2004-05-07, released 2004-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: orf k3
  Species: HUMAN HERPESVIRUS 8 [TaxId:37296]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P90495 (0-59)
  Domains in SCOPe 2.08: d1vyxa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vyxA (A:)
  mededvpvcwicneelgnerfracgctgelenvhrsclstwltisrntacqicgvvyntr