PDB entry 1vyu

View 1vyu on RCSB PDB site
Description: beta3 subunit of voltage-gated ca2+-channel
Class: ion transport
Keywords: calcium channel beta subunit, aid doamin, ion transport, ionic channel, voltage-gated channel, sh3 domain
Deposited on 2004-05-07, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium channel beta-3 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyua1, d1vyua2
  • Chain 'B':
    Compound: calcium channel beta-3 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyub1, d1vyub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyuA (A:)
    gsadsytsrpsldsdvsleedresarrevesqaqqqlerakhkpvafavrtnvsycgvld
    eecpvqgsgvnfeakdflhikekysndwwigrlvkeggdiafipspqrlesirlkqeqka
    rrsgnpsslsdignrrspppslakqkqkqaehvppydvvpsmrpvvlvgpslkgyevtdm
    mqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgkrtiierssarssiaevqseie
    rifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhl
    tvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathhpapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyuA (A:)
    sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek
    ysndwwigrlvkeggdiafipspqrlesirlkqeqkvppydvvpsmrpvvlvgpslkgye
    vtdmmqkalfdflkhrfdgrisitrvtadlslaksiaevqseierifelakslqlvvlda
    dtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhltvqmmaydklvqcppe
    sfdvildenqlddacehlaeylevywrathhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vyuB (B:)
    gsadsytsrpsldsdvsleedresarrevesqaqqqlerakhkpvafavrtnvsycgvld
    eecpvqgsgvnfeakdflhikekysndwwigrlvkeggdiafipspqrlesirlkqeqka
    rrsgnpsslsdignrrspppslakqkqkqaehvppydvvpsmrpvvlvgpslkgyevtdm
    mqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgkrtiierssarssiaevqseie
    rifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhl
    tvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathhpapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyuB (B:)
    vsleedresarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeak
    dflhikekysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnhvppydvvps
    mrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakssiaevqseie
    rifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhl
    tvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathh