PDB entry 1vyt

View 1vyt on RCSB PDB site
Description: beta3 subunit complexed with aid
Class: transport protein
Keywords: transport protein, ion transport/complex, calcium channel beta subunit, aid doamin, ion transport, ionic channel, voltage-gated channel, sh3 domain
Deposited on 2004-05-07, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium channel beta-3 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyta1, d1vyta2
  • Chain 'B':
    Compound: calcium channel beta-3 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vytb1, d1vytb2
  • Chain 'E':
    Compound: Voltage-dependent L-type calcium channel alpha-1C subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyte_
  • Chain 'F':
    Compound: Voltage-dependent L-type calcium channel alpha-1C subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vytf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vytA (A:)
    gsadsytsrpsldsdvsleedresarrevesqaqqqlerakhkpvafavrtnvsycgvld
    eecpvqgsgvnfeakdflhikekysndwwigrlvkeggdiafipspqrlesirlkqeqka
    rrsgnpsslsdignrrspppslakqkqkqaehvppydvvpsmrpvvlvgpslkgyevtdm
    mqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgkrtiierssarssiaevqseie
    rifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhl
    tvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathhpapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vytA (A:)
    esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
    kysndwwigrlvkeggdiafipspqrlesirlkqeqkarhvppydvvpsmrpvvlvgpsl
    kgyevtdmmqkalfdflkhrfdgrisitrvtadlslasiaevqseierifelakslqlvv
    ldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhltvqmmaydklvqc
    ppesfdvildenqlddacehlaeylevywrathh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vytB (B:)
    gsadsytsrpsldsdvsleedresarrevesqaqqqlerakhkpvafavrtnvsycgvld
    eecpvqgsgvnfeakdflhikekysndwwigrlvkeggdiafipspqrlesirlkqeqka
    rrsgnpsslsdignrrspppslakqkqkqaehvppydvvpsmrpvvlvgpslkgyevtdm
    mqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgkrtiierssarssiaevqseie
    rifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkhl
    tvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathhpapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vytB (B:)
    esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
    kysndwwigrlvkeggdiafipspqrlesirlkqeqkahvppydvvpsmrpvvlvgpslk
    gyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgkrtiierssarssia
    evqseierifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrg
    ksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeylevywrathhp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vytE (E:)
    qklrekqqleedlkgyldwitqaed
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vytF (F:)
    qklrekqqleedlkgyldwitqaed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vytF (F:)
    leedlkgyldwitqaed