PDB entry 1vys

View 1vys on RCSB PDB site
Description: structure of pentaerythritol tetranitrate reductase w102y mutant and complexed with picric acid
Class: oxidoreductase
Keywords: flavoenzyme, explosive degradation, steroid binding, oxidoreductase
Deposited on 2004-05-05, released 2004-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.14495
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Pentaerythritol tetranitrate reductase
    Species: ENTEROBACTER CLOACAE [TaxId:550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (0-363)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d1vysx_
  • Heterogens: FMN, TNF, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vysX (X:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlyhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl