PDB entry 1vyr

View 1vyr on RCSB PDB site
Description: Structure of pentaerythritol tetranitrate reductase complexed with picric acid
Class: oxidoreductase
Keywords: oxidoreductase, flavoenzyme, explosive degradation, steroid binding
Deposited on 2004-05-05, released 2004-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: 0.1162
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyra_
  • Heterogens: FMN, TNF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyrA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyrA (A:)
    aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
    saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
    asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
    sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
    nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
    aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
    psl