PDB entry 1vyo

View 1vyo on RCSB PDB site
Description: Crystal structure of avidin
Class: glycoprotein
Keywords: glycoprotein, biotin
Deposited on 2004-05-03, released 2005-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vyoa_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vyob_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyoA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyoA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vyoB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyoB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl