PDB entry 1vym

View 1vym on RCSB PDB site
Description: native human pcna
Class: DNA-binding protein
Keywords: DNA, replication, processivity, oncogene, DNA-binding protein, DNA replication, DNA-binding systemic lupus erythematosus
Deposited on 2004-05-03, released 2005-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyma1, d1vyma2
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vymb1, d1vymb2
  • Chain 'C':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vymc1, d1vymc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vymA (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vymA (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vymB (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vymB (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vymC (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vymC (C:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkie