PDB entry 1vyk

View 1vyk on RCSB PDB site
Description: crystal structure of psbq protein of photosystem ii from higher plants
Deposited on 2004-04-30, released 2005-05-26
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.164
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxygen-evolving enhancer protein 3
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vykA (A:)
    earpivvgpppplsgglpgtensdqardgtlpytkdrfylqplppteaaqrakvsaseil
    nvkqfidrkawpslqndlrlrasylrydlktvisakpkdekkslqeltsklfssidnldh
    aakikspteaekyygqtvsninevlaklg
    

    Sequence, based on observed residues (ATOM records):
    >1vykA (A:)
    earpivvgppppltkdrfylqplppteaaqrakvsaseilnvkqfidrkawpslqndlrl
    rasylrydlktvisakpkdekkslqeltsklfssidnldhaakikspteaekyygqtvsn
    inevlaklg