PDB entry 1vyi

View 1vyi on RCSB PDB site
Description: structure of the c-terminal domain of the polymerase cofactor of rabies virus: insights in function and evolution.
Class: transferase
Keywords: transferase, rabies virus, replication, transcription, polymerase, RNA-directed RNA polymerase, phosphorylation
Deposited on 2004-04-30, released 2004-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase alpha subunit
    Species: RABIES VIRUS (STRAIN CVS-11)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyia_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyiA (A:)
    wsatneeddlsveaeiahqiaesfskkykfpsrssgiflynfeqlkmnlddivkeaknvp
    gvtrlahdgskiplrcvlgwvalanskkfqllveadklskimqddlnrytsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyiA (A:)
    wsatneeddlsveaeiahqiaesfskkykfpsrssgiflynfeqlkmnlddivkeaknvp
    gvtrlahdgskiplrcvlgwvalanskkfqllveadklskimqddlnryts