PDB entry 1vyh

View 1vyh on RCSB PDB site
Description: paf-ah holoenzyme: lis1/alfa2
Class: hydrolase
Keywords: lissencephaly, acetylhydrolase, platelet activacting factor, regulator of cytoplasmic dynein, hydrolase, cell division, mitosis, neurogenesis, cytoskeleton
Deposited on 2004-04-30, released 2005-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.265
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyha1
  • Chain 'B':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhb1
  • Chain 'C':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhc1
  • Chain 'D':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhd1
  • Chain 'E':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhe1
  • Chain 'F':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhf1
  • Chain 'G':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhg1
  • Chain 'H':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhh1
  • Chain 'I':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhi1
  • Chain 'J':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhj1
  • Chain 'K':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhk1
  • Chain 'L':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhl1
  • Chain 'M':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhm1
  • Chain 'N':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhn1
  • Chain 'O':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyho1
  • Chain 'P':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhp1
  • Chain 'Q':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhq1
  • Chain 'R':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyhr1
  • Chain 'S':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyhs1
  • Chain 'T':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYH
      • conflict (198)
      • conflict (275)
    • Uniprot P63005
    Domains in SCOPe 2.07: d1vyht1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyhA (A:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhA (A:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vyhB (B:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhB (B:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vyhC (C:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhC (C:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vyhD (D:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhD (D:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vyhE (E:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhE (E:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vyhF (F:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhF (F:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vyhG (G:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhG (G:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vyhH (H:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhH (H:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1vyhI (I:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhI (I:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1vyhJ (J:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhJ (J:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1vyhK (K:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhK (K:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vyhL (L:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhL (L:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1vyhM (M:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhM (M:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1vyhN (N:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhN (N:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1vyhO (O:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhO (O:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1vyhP (P:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhP (P:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1vyhQ (Q:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhQ (Q:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1vyhR (R:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhR (R:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqlleetpee
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1vyhS (S:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhS (S:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1vyhT (T:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeeftsggplgqkrdpkewiprppekyalsghrspvtrvifhpvf
    svmvsasedatikvwdyetgdfertlkghtdsvqdisfdhsgkllascsadmtiklwdfq
    gfecirtmhghdhnvssvsimpngdhivsasrdktikmwevqtgycvktftghrewvrmv
    rpnqdgtliascsndqtvrvwvvatkeckaelrehrhvveciswapessyssiseatgse
    tkksgkpgpfllsgsrdktikmwdvstgmclmtlvghdnwvrgvlfhsggkfilscaddk
    tlrvwdyknkrcmktlnahehfvtsldfhktapyvvtgsvdqtvkvwecr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyhT (T:)
    kewiprppekyalsghrspvtrvifhpvfsvmvsasedatikvwdyetgdfertlkghtd
    svqdisfdhsgkllascsadmtiklwdfqgfecirtmhghdhnvssvsimpngdhivsas
    rdktikmwevqtgycvktftghrewvrmvrpnqdgtliascsndqtvrvwvvatkeckae
    lrehrhvveciswapessyssiseatgsegpfllsgsrdktikmwdvstgmclmtlvghd
    nwvrgvlfhsggkfilscaddktlrvwdyknkrcmktlnahehfvtsldfhktapyvvtg
    svdqtvkvwe