PDB entry 1vyg

View 1vyg on RCSB PDB site
Description: schistosoma mansoni fatty acid binding protein in complex with arachidonic acid
Class: transport protein
Keywords: fatty acid binding protein, transport protein
Deposited on 2004-04-29, released 2004-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid binding protein
    Species: SCHISTOSOMA MANSONI [TaxId:6183]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYG (0-1)
    • Uniprot P29498 (2-134)
    Domains in SCOPe 2.07: d1vyga_
  • Heterogens: ACD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vygA (A:)
    gsmssflgkwklseshnfdavmsklgvswatrqigntvtptvtftmdgdkmtmltestfk
    nlsctfkfgeefdektsdgrnvksvveknseskltqtqvdpknttvivrevdgdtmkttv
    tvgdvtairnykrls