PDB entry 1vyd

View 1vyd on RCSB PDB site
Description: crystal structure of cytochrome c2 mutant g95e
Deposited on 2004-04-27, released 2004-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-17, with a file datestamp of 2004-06-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vyda_
  • Chain 'B':
    Domains in SCOP 1.69: d1vydb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vydA (A:)
    gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
    gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vydB (B:)
    gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
    gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk