PDB entry 1vyd

View 1vyd on RCSB PDB site
Description: Crystal structure of cytochrome C2 mutant G95E
Class: electron transport
Keywords: electron transport, redox
Deposited on 2004-04-27, released 2004-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00094 (0-115)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d1vyda_
  • Chain 'B':
    Compound: cytochrome c2
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00094 (0-115)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d1vydb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vydA (A:)
    gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
    gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vydB (B:)
    gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
    gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk