PDB entry 1vyc

View 1vyc on RCSB PDB site
Description: neurotoxin from bungarus candidus
Class: neurotoxin
Keywords: snake neurotoxin, neurotoxin
Deposited on 2004-04-26, released 2004-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: THEORY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -5.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bucain
    Species: BUNGARUS CANDIDUS [TaxId:92438]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vycA (A:)
    rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
    dkcna