PDB entry 1vyc

View 1vyc on RCSB PDB site
Description: Neurotoxin from Bungarus candidus
Class: neurotoxin
Keywords: snake neurotoxin, neurotoxin
Deposited on 2004-04-26, released 2004-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: THEORY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -5.91 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bucain
  Species: BUNGARUS CANDIDUS [TaxId:92438]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83346 (0-64)
  Domains in SCOPe 2.08: d1vyca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vycA (A:)
  rkclikysqanessktcpsgqllclkkweignpsgkevkrgcvatcpkpwkneiiqccak
  dkcna