PDB entry 1vyb

View 1vyb on RCSB PDB site
Description: endonuclease domain of human line1 orf2p
Deposited on 2004-04-25, released 2004-06-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-29, with a file datestamp of 2004-07-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1878
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vyba_
  • Chain 'B':
    Domains in SCOP 1.69: d1vybb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vybA (A:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vybA (A:)
    gsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrki
    yqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgap
    rfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyr
    tlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vybB (B:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vybB (B:)
    shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
    ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
    kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
    pksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr