PDB entry 1vyb

View 1vyb on RCSB PDB site
Description: endonuclease domain of human line1 orf2p
Class: transferase
Keywords: endonuclease, ape-1 type, retrotransposition, retrotransposon, transferase, RNA-directed DNA polymerase
Deposited on 2004-04-25, released 2004-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf2 contains a reverse transcriptase domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vyba_
  • Chain 'B':
    Compound: orf2 contains a reverse transcriptase domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vybb_
  • Heterogens: SO4, SO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vybA (A:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vybA (A:)
    gsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrki
    yqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgap
    rfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyr
    tlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vybB (B:)
    mtgsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwr
    kiyqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntg
    aprfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidi
    yrtlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vybB (B:)
    shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
    ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
    kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
    pksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr