PDB entry 1vya

View 1vya on RCSB PDB site
Description: Identification and characterization of the first plant G-quadruplex binding protein encoded by the Zea mays L. nucleoside diphosphate1 gene, ZmNDPK1
Class: transferase
Keywords: G4-binding protein, NDPK, DNA metabolism, G-quadruplex, TRANSFERASE
Deposited on 2014-08-14, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyaa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyab_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyac_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyad_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyae_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyaf_
  • Chain 'G':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyag_
  • Chain 'H':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyah_
  • Chain 'I':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyai_
  • Chain 'J':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyaj_
  • Chain 'K':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyak_
  • Chain 'L':
    Compound: Nucleoside diphosphate kinase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYA (0-148)
    Domains in SCOPe 2.07: d1vyal_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaA (A:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaB (B:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaC (C:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaD (D:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaE (E:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaF (F:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaG (G:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaH (H:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaI (I:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaJ (J:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaK (K:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vyaL (L:)
    mestfimikpdgvqrgligeiisrfekkgfylkalklvnversfaekhyadlaskpffqg
    lvdyiisgpvvamvwegksvvttgrkiigatnplasepgtirgdfavdigrnvihgsdsi
    esankeialwfpegladwqssqhpwiyek