PDB entry 1vy9

View 1vy9 on RCSB PDB site
Description: crystal structure of the e. coli crispr rna-guided surveillance complex, cascade
Deposited on 2014-06-28, released 2014-08-20
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.234
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR system Cascade subunit CasE
    Species: Escherichia coli [TaxId:83333]
    Gene: casE, cas6e, ygcH, b2756, JW2726
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: CRISPR system Cascade subunit CasD
    Species: Escherichia coli [TaxId:83333]
    Gene: casD, cas5, ygcI, b2757, JW5844
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: CRISPR system Cascade subunit CasA
    Species: Escherichia coli [TaxId:83333]
    Gene: casA, cse1, ygcL, b2760, JW2730
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: CRISPR system Cascade subunit CasB
    Species: Escherichia coli [TaxId:83333]
    Gene: casB, cse2, ygcK, b2759, JW2729
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: CRISPR system Cascade subunit CasB
    Species: Escherichia coli [TaxId:83333]
    Gene: casB, cse2, ygcK, b2759, JW2729
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76632 (5-164)
      • expression tag (4)
  • Chain 'L':
    Compound: Escherichia coli strain ECOR44 cluster 1 CRISPR region
    Species: Escherichia coli [TaxId:562]
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vy9A (A:)
    mylskviiarawsrdlyqlhqglwhlfpnrpdaardflfhvekrntpegchvllqsaqmp
    vstavatviktkqvefqlqvgvplyfrlranpiktildnqkrldskgnikrcrvplikea
    eqiawlqrklgnaarvedvhpiserpqyfsgdgksgkiqtvcfegvltindapalidlvq
    qgigpaksmgcgllslapl
    

    Sequence, based on observed residues (ATOM records):
    >1vy9A (A:)
    mylskviiarawsrdlyqlhqglwhlfpdflfhvekrntpegchvllqsaqmpvstavat
    viktkqvefqlqvgvplyfrlranpiktildnqkrldskgnikrcrvplikeaeqiawlq
    rklgnaarvedvhpiserpqyfsgdgksgkiqtvcfegvltindapalidlvqqgigpak
    smgcgllslapl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vy9B (B:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9B (B:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksadavtpwvvgeiawfceqvaka
    eadnlddkkllkvlkediaairvnlqqgvdialsgrmatgmmtelgkvdgamsiahaitt
    hqvdsdidwftavddlqeqlgtqefssgvfyryaninlaqlqenlggasreqaleiathv
    vhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflqpsiqafnq
    ywdrvangyglngaaaqfsldpitaqvkqmptleqlkswvrnnge
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vy9C (C:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9C (C:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvisadavtpwvvgeiawfceqv
    akaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgamsiah
    aitthqvdsdidwftavddlqsahlgtqefssgvfyryaninlaqlqenlggasreqale
    iathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflqpsi
    qafnqywdrvangyglngaaaqfslsdqvkqmptleqlkswvrnnge
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vy9D (D:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9D (D:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdekisadavtpwvvgeiawfc
    eqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgams
    iahaitthqvdsdidwftavddlqsahlgtqefssgvfyryaninlaqlqenlggasreq
    aleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflq
    psiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnnge
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vy9E (E:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9E (E:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvkisadavtpwvvgeiawfceq
    vakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgamsia
    haitthqvdsdidwftavddlqahlgtqefssgvfyryaninlaqlqenlggasreqale
    iathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflqpsi
    qafnqywdrvangyglngaaaqfslsdvdaqvkqmptleqlkswvrnngea
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vy9F (F:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9F (F:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdkisadavtpwvvgeiawfce
    qvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgamsi
    ahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlggasr
    eqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgf
    lqpsiqafnqywdrvangyglngaaaqfslsdvdpqvkqmptleqlkswvrnngea
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vy9G (G:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy9G (G:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksisadavtpwvvgeiawfceqva
    kaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgamsiaha
    itthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlggasreqa
    leiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflqp
    siqafnqywdrvangyglngaaaqfslsdvdpiqvkqmptleqlkswvrnnge
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vy9H (H:)
    mrsylilrlagpmqawgqptfegtrptgrfptrsgllgllgaclgiqrddtsslqalses
    vqfavrcdelilddrrvsvtglrdyhtvlgaredyrglkshetiqtwreylcdasftval
    wltphatmviselekavlkprytpylgrrscplthplflgtcqasdpqkallnyepvggd
    iyseesvtghhlkftardepmitlprqfasrewyvikggmdvsq
    

    Sequence, based on observed residues (ATOM records):
    >1vy9H (H:)
    mrsylilrlagpmqawgqptfegtrptgrfptrsgllgllgaclgiqrddtsslqalses
    vqfavrcdelilddrrvsvtglrdyhtvlgaredyrglkshetiqtwreylcdasftval
    wltphatmviselekavlkprytpylgrrscplthplflgtcqasdpqkallnyepvggd
    iyseesvtghhlkftardepmitlprqfasrewyvikgg
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vy9I (I:)
    mnllidnwipvrprnggkvqiinlqslycsrdqwrlslprddmelaalallvcigqiiap
    akddvefrhrimnpltedefqqliapwidmfylnhaehpfmqtkgvkandvtpmekllag
    vsgatncafvnqpgqgealcggctaialfnqanqapgfgggfksglrggtpvttfvrgid
    lrstvllnvltlprlqkqfpneshtenqptwikpiksnesipassigfvrglfwqpahie
    lcdpigigkcsccgqesnlrytgflkekftftvnglwphphspclvtvkkgeveekflaf
    ttsapswtqisrvvvdkiiqnengnrvaavvnqfrniapqsplelimggyrnnqasiler
    rhdvlmfnqgwqqygnvineivtvglgyktalrkalytfaegfknkdfkgagvsvhetae
    rhfyrqsellipdvlanvnfsqadeviadlrdklhqlcemlfnqsvapyahhpklistla
    laratlykhlrelkpqggpsng
    

    Sequence, based on observed residues (ATOM records):
    >1vy9I (I:)
    llidnwipvrprnggkvqiinlqslycsrdqwrlslprddmelaalallvcigqiiapak
    ddvefrhrimnpltedefqqliapwidmfylnhaehpfmqtkgvkandvtpmekllagvs
    gatncafvnqpgqgealcggctaialfnqanqapgfgggfksglrggtpvttfvrgidlr
    stvllnvltlprlqkqfpneshtenqptwikpiksnesipassigfvrglfwqpahielc
    dpigigkcsccgqesnlrytgflkekftftvnglwphphspclvtvkkgeveekflaftt
    sapswtqisrvvvdkiiqnngnrvaavvnqfrniapqsplelimggyrnnqasilerrhd
    vlmfnqgwqqygnvineivtvglgyktalrkalytfaegfknkdfkgagvsvhetaerhf
    yrqsellipdvlanvnfsqadeviadlrdklhqlcemlfnqsvapyahhpklistlalar
    atlykhlrelkpq
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vy9J (J:)
    gpgyqmadeidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhq
    qallrmvfclsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmv
    qlrrllthaepvldwplmarmltwwgkrerqqlledfvlttnkna
    

    Sequence, based on observed residues (ATOM records):
    >1vy9J (J:)
    eidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhqqallrmvf
    clsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmvqlrrllth
    aepvldwplmarmltwwgkrerqqlledfvlttnkna
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vy9K (K:)
    gpgyqmadeidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhq
    qallrmvfclsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmv
    qlrrllthaepvldwplmarmltwwgkrerqqlledfvlttnkna
    

    Sequence, based on observed residues (ATOM records):
    >1vy9K (K:)
    qmadeidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhqqall
    rmvfclsagknvirhqdkttgislgralansgrinerrifqliradrtadmvqlrrllth
    aepvldwplmarmltwwgkrerqqlledfvlttnkna
    

  • Chain 'L':
    No sequence available.