PDB entry 1vy8

View 1vy8 on RCSB PDB site
Description: crystal structure of the e. coli crispr rna-guided surveillance complex, cascade
Deposited on 2014-06-28, released 2014-08-20
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.234
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: CRISPR system Cascade subunit CasE
    Species: Escherichia coli [TaxId:83333]
    Gene: casD, cas5, ygcI, b2757, JW5844
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: CRISPR system Cascade subunit CasC
    Species: Escherichia coli [TaxId:83333]
    Gene: casC, cas4, cse4, ygcJ, b2758, JW2728
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: CRISPR system Cascade subunit CasD
    Species: Escherichia coli [TaxId:83333]
    Gene: casE, cas6e, ygcH, b2756, JW2726
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: CRISPR system Cascade subunit CasA
    Species: Escherichia coli [TaxId:83333]
    Gene: casA, cse1, ygcL, b2760, JW2730
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: CRISPR system Cascade subunit CasB
    Species: Escherichia coli [TaxId:83333]
    Gene: casB, cse2, ygcK, b2759, JW2729
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: CRISPR system Cascade subunit CasB
    Species: Escherichia coli [TaxId:83333]
    Gene: casB, cse2, ygcK, b2759, JW2729
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Escherichia coli strain ECOR44 cluster 1 CRISPR region
    Species: Escherichia coli [TaxId:562]
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vy8M (M:)
    mylskviiarawsrdlyqlhqglwhlfpnrpdaardflfhvekrntpegchvllqsaqmp
    vstavatviktkqvefqlqvgvplyfrlranpiktildnqkrldskgnikrcrvplikea
    eqiawlqrklgnaarvedvhpiserpqyfsgdgksgkiqtvcfegvltindapalidlvq
    qgigpaksmgcgllslapl
    

    Sequence, based on observed residues (ATOM records):
    >1vy8M (M:)
    mylskviiarawsrdlyqlhqglwhlfpaardflfhvekrntpegchvllqsaqmpvsta
    vatviktkqvefqlqvgvplyfrlranpiktildnqkrldskgnikrcrvplikeaeqia
    wlqrklgnaarvedvhpiserpqyfsgdgksgkiqtvcfegvltindapalidlvqqgig
    paksmgcgllslapl
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vy8N (N:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8N (N:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeekisadavtpwvvgeiawf
    ceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgam
    siahaitthqvdsdidwftavddlqeqgsahtqefssgvfyryaninlaqlqenlggasr
    eqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgf
    lqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnnge
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vy8O (O:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8O (O:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeiaw
    fceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdga
    msiahaitthqvdsdidwftavddlqahlgtqefssgvfyryaninlaqlqenlggasre
    qaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgfl
    qpsiqafnqywdrvangyglngaaaqfslsdpitaqvkqmptleqlkswvrnnge
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vy8P (P:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8P (P:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdkisadavtpwvvgeiawfce
    qvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgamsi
    ahaitthqvdsdidwftavddlqahlgtqefssgvfyryaninlaqlqenlggasreqal
    eiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgflqps
    iqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnnge
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vy8Q (Q:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8Q (Q:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeakisadavtpwvvgeiawf
    ceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdgam
    siahaitthqvdsdidwftavddlqeahlgtqefssgvfyryaninlaqlqenlggasre
    qaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdgfl
    qpsiqafnqywdrvangyglngaaaqfslsdvdaqvkqmptleqlkswvrnnge
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vy8R (R:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8R (R:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeiaw
    fceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdga
    msiahaitthqvdsdidwftavddlqesahlgtqefssgvfyryaninlaqlqenlggas
    reqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkakdg
    flqpsiqafnqywdrvangyglngaaaqfslsdvpitaqvkqmptleqlkswvrnngea
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vy8S (S:)
    msnfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqnige
    sslrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeia
    wfceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdg
    amsiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlg
    gasreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavka
    kdgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnn
    gea
    

    Sequence, based on observed residues (ATOM records):
    >1vy8S (S:)
    snfinihvlishspsclnrddmnmqkdaifggkrrvrissqslkramrksgyyaqniges
    slrtihlaqlrdvlrqklgerfdqkiidktlallsgksvdeaekisadavtpwvvgeiaw
    fceqvakaeadnlddkkllkvlkediaairvnlqqgvdialsgrmatsgmmtelgkvdga
    msiahaitthqvdsdidwftavddlqeqgsahlgtqefssgvfyryaninlaqlqenlgg
    asreqaleiathvvhmlatevpgakqrtyaafnpadmvmvnfsdmplsmanafekavkak
    dgflqpsiqafnqywdrvangyglngaaaqfslsdvdpitaqvkqmptleqlkswvrnng
    e
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vy8T (T:)
    mrsylilrlagpmqawgqptfegtrptgrfptrsgllgllgaclgiqrddtsslqalses
    vqfavrcdelilddrrvsvtglrdyhtvlgaredyrglkshetiqtwreylcdasftval
    wltphatmviselekavlkprytpylgrrscplthplflgtcqasdpqkallnyepvggd
    iyseesvtghhlkftardepmitlprqfasrewyvikggmdvsq
    

    Sequence, based on observed residues (ATOM records):
    >1vy8T (T:)
    mrsylilrlagpmqawgqptfegtrptgrfptrsgllgllgaclgiqrddtsslqalses
    vqfavrcdelilddrrvsvtglrdyhtvlgaredyrglkshetiqtwreylcdasftval
    wltphatmviselekavlkprytpylgrrscplthplflgtcqasdpqkallnyepvggd
    iyseesvtghhlkftardepmitlprqfasrewyvikgg
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vy8U (U:)
    mnllidnwipvrprnggkvqiinlqslycsrdqwrlslprddmelaalallvcigqiiap
    akddvefrhrimnpltedefqqliapwidmfylnhaehpfmqtkgvkandvtpmekllag
    vsgatncafvnqpgqgealcggctaialfnqanqapgfgggfksglrggtpvttfvrgid
    lrstvllnvltlprlqkqfpneshtenqptwikpiksnesipassigfvrglfwqpahie
    lcdpigigkcsccgqesnlrytgflkekftftvnglwphphspclvtvkkgeveekflaf
    ttsapswtqisrvvvdkiiqnengnrvaavvnqfrniapqsplelimggyrnnqasiler
    rhdvlmfnqgwqqygnvineivtvglgyktalrkalytfaegfknkdfkgagvsvhetae
    rhfyrqsellipdvlanvnfsqadeviadlrdklhqlcemlfnqsvapyahhpklistla
    laratlykhlrelkpqggpsng
    

    Sequence, based on observed residues (ATOM records):
    >1vy8U (U:)
    llidnwipvrprnggkvqiinlqslycsrdqwrlslprddmelaalallvcigqiiapak
    ddvefrhrimnpltedefqqliapwidmfylnhaehpfmqtkgvkandvtpmekllagvs
    gatncafvnqpgqgealcggctaialfnqanqapgfgggfksglrggtpvttfvrgidlr
    stvllnvltlprlqkqfpneshtenqptwikpiksnesipassigfvrglfwqpahielc
    dpigigkcsccgqesnlrytgflkekftftvnglwphphspclvtvkkgeveekflaftt
    sapswtqisrvvvdkiiqnngnrvaavvnqfrniapqsplelimggyrnnqasilerrhd
    vlmfnqgwqqygnvineivtvglgyktalrkalytfaegfknkdfkgagvsvhetaerhf
    yrqsellipdvlanvnfsqadeviadlrdklhqlcemlfnqsvapyahhpklistlalar
    atlykhlrelkpq
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vy8V (V:)
    gpgyqmadeidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhq
    qallrmvfclsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmv
    qlrrllthaepvldwplmarmltwwgkrerqqlledfvlttnkna
    

    Sequence, based on observed residues (ATOM records):
    >1vy8V (V:)
    eidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhqqallrmvf
    clsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmvqlrrllth
    aepvldwplmarmltwwgkrerqqlledfvlttnk
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vy8W (W:)
    gpgyqmadeidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhq
    qallrmvfclsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmv
    qlrrllthaepvldwplmarmltwwgkrerqqlledfvlttnkna
    

    Sequence, based on observed residues (ATOM records):
    >1vy8W (W:)
    eidamalyrawqqldngscaqirrvsepdelrdipafyrlvqpfgwenprhqqallrmvf
    clsagknvirhqdkkseqttgislgralansgrinerrifqliradrtadmvqlrrllth
    aepvldwplmarmltwwgkrerqqlledfvlttnkna
    

  • Chain 'X':
    No sequence available.