PDB entry 1vxv

View 1vxv on RCSB PDB site
Description: Structures of yeast 80S ribosome-tRNA complexes in the rotated and non-rotated conformations (Class II - rotated ribosome with 1 tRNA, this entry contains the large ribosomal subunit proteins)
Deposited on 2014-05-29, released 2014-08-06
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 6.2 Å
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S ribosomal protein L1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 60S ribosomal protein L2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 60S Ribosomal protein L3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 60S Ribosomal protein L4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 60S Ribosomal protein L5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 60S ribosomal protein L6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 60S Ribosomal protein L7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 60S Ribosomal protein L8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 60S ribosomal protein L9
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 60S ribosomal protein L10
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 60S Ribosomal protein L11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 60S ribosomal protein L12
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 60s ribosomal protein l13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 60S ribosomal protein L14
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 60S ribosomal protein L15
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 60S ribosomal protein L16
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 60S Ribosomal protein L17
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 60S Ribosomal protein L18
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 60S Ribosomal protein L19
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 60S ribosomal protein L20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 60S Ribosomal protein L21
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 60S ribosomal protein L22
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 60s ribosomal protein l23
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 60S Ribosomal protein L24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 60S ribosomal protein L25
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 60S Ribosomal protein L26
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: 60S ribosomal protein L27
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 60S ribosomal protein L28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: 60S ribosomal protein L29
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: 60s ribosomal protein l30
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: 60S Ribosomal protein L31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 60S Ribosomal protein L32
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: 60S ribosomal protein L33
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: 60S ribosomal protein L34
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: 60S Ribosomal protein L35
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: 60s ribosomal protein l36
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: 60S ribosomal protein L37
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: 60S ribosomal protein L38
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: 60S ribosomal protein L39
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: 60S ribosomal protein L40
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: 60S ribosomal protein L41
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: 60S ribosomal protein L42
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: 60S ribosomal protein L43
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: 60S acidic ribosomal protein P0
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: Guanine nucleotide-binding protein subunit beta-like protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vxvA (A:)
    mskitssqvrehvkellkysnetkkrnfletvelqvglknydpqrdkrfsgslklpncpr
    pnmsicifgdafdvdrakscgvdamsvddlkklnknkklikklskkynafiasevlikqv
    prllgpqlskagkfptpvshnddlygkvtdvrstikfqlkkvlclavavgnvemeedvlv
    nqilmsvnffvsllkknwqnvgslvvkssmgpafrly
    

    Sequence, based on observed residues (ATOM records):
    >1vxvA (A:)
    vkellkysnetkkrnfletvelqvglknydpqrdkrfsgslklpncprpnmsicifgdaf
    dvdrakscgvdamsvddlkklnknkklikklskkynafiasevlikqvprllgpqlskag
    kfptpvshnddlygkvtdvrstikfqlkkvlclavavgnvemeedvlvnqilmsvnffvs
    llkknwqnvgslvvkssmgpafrl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vxvB (B:)
    mgrvirnqrkgagsiftshtrlrqgaaklrtldyaerhgyirgivkqivhdsgrgaplak
    vvfrdpykyrlreeifianegvhtgqfiyagkkaslnvgnvlplgsvpegtivsnveekp
    gdrgalarasgnyviiighnpdenktrvrlpsgakkvissdargvigviagggrvdkpll
    kagrafhkyrlkrnswpktrgvamnpvdhphgggnhqhigkastisrgavsgqkagliaa
    rrtgllrgsqktqd
    

    Sequence, based on observed residues (ATOM records):
    >1vxvB (B:)
    grvirnqrkgagsiftshtrlrqgaaklrtldyaerhgyirgivkqivhdsgrgaplakv
    vfrdpykyrlreeifianegvhtgqfiyagkkaslnvgnvlplgsvpegtivsnveekpg
    drgalarasgnyviiighnpdenktrvrlpsgakkvissdargvigviagggrvdkpllk
    agrafhkyrlkrnswpktrgvamnpvdhphgggnhqhigkastisrgavsgqkagliaar
    rtgllrgsqktq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vxvC (C:)
    mshrkyeaprhghlgflprkraasirarvkafpkddrskpvaltsflgykagmttivrdl
    drpgskfhkrevveavtvvdtppvvvvgvvgyvetprglrslttvwaehlsdevkrrfyk
    nwykskkkaftkysakyaqdgagierelarikkyasvvrvlvhtqirktplaqkkahlae
    iqlnggsisekvdwarehfektvavdsvfeqnemidaiavtkghgfegvthrwgtkklpr
    kthrglrkvacigawhpahvmwsvaragqrgyhsrtsinhkiyrvgkgddeangatsfdr
    tkktitpmggfvhygeikndfimvkgcipgnrkrivtlrkslytntsrkaleevslkwid
    taskfgkgrfqtpaekhafmgtlkkdl
    

    Sequence, based on observed residues (ATOM records):
    >1vxvC (C:)
    shrkyeaprhghlgflprkraasirarvkafpkddrskpvaltsflgykagmttivrdld
    rpgskfhkrevveavtvvdtppvvvvgvvgyvetprglrslttvwaehlsdevkrrfykn
    wykskkkaftkysakyaqdgagierelarikkyasvvrvlvhtqirktplaqkkahlaei
    qlnggsisekvdwarehfektvavdsvfeqnemidaiavtkghgfegvthrwgtkklprk
    thrglrkvacigawhpahvmwsvaragqrgyhsrtsinhkiyrvgkgddeangatsfdrt
    kktitpmggfvhygeikndfimvkgcipgnrkrivtlrkslytntsrkaleevslkwidt
    askfgkgrfqtpaekhafmgtlkkdl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vxvD (D:)
    msrpqvtvhsltgeatanalplpavfsapirpdivhtvftsvnknkrqayavsekaghqt
    saeswgtgravariprvggggtgrsgqgafgnmcrggrmfaptktwrkwnvkvnhnekry
    atasaiaatavaslvlarghrvekipeiplvvstdlesiqktkeavaalkavgahsdllk
    vlkskklragkgkyrnrrwtqrrgplvvyaedngivkalrnvpgvetanvaslnllqlap
    gahlgrfviwteaaftkldqvwgsetvasskvgytlpshiistsdvtriinsseiqsair
    pagqatqkrthvlkknplknkqvllrlnpyakvfaaeklgskkaektgtkpaavftetlk
    hd
    

    Sequence, based on observed residues (ATOM records):
    >1vxvD (D:)
    srpqvtvhsltgeatanalplpavfsapirpdivhtvftsvnknkrqayavsekaghqts
    aeswgtgravariprvggggtgrsgqgafgnmcrggrmfaptktwrkwnvkvnhnekrya
    tasaiaatavaslvlarghrvekipeiplvvstdlesiqktkeavaalkavgahsdllkv
    lkskklragkgkyrnrrwtqrrgplvvyaedngivkalrnvpgvetanvaslnllqlapg
    ahlgrfviwteaaftkldqvwgsetvasskvgytlpshiistsdvtriinsseiqsairp
    agqatqkrthvlkknplknkqvllrlnpyakvfaaeklgskkaektgtkpaavftetlkh
    d
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vxvE (E:)
    mafqkdakssayssrfqtpfrrrregktdyyqrkrlvtqhkakyntpkyrlvvrftnkdi
    icqiisstitgdvvlaaayshelprygithgltnwaaayatglliarrtlqklgldetyk
    gveevegeyelteavedgprpfkvfldiglqrtttgarvfgalkgasdgglyvphsenrf
    pgwdfeteeidpellrsyifgghvsqymeeladddeerfselfkgyladdidadslediy
    tsaheairadpafkptekkftkeqyaaeskkyrqtklskeeraarvaakiaalagqq
    

    Sequence, based on observed residues (ATOM records):
    >1vxvE (E:)
    afqkdakssayssrfqtpfrrrregktdyyqrkrlvtqhkakyntpkyrlvvrftnkdii
    cqiisstitgdvvlaaayshelprygithgltnwaaayatglliarrtlqklgldetykg
    veevegeyelteavedgprpfkvfldiglqrtttgarvfgalkgasdgglyvphsenrfp
    gwdfeteeidpellrsyifgghvsqymeeladddeerfselfkgyladdidadslediyt
    saheairadpafkptekkftkeqyaaeskkyrqtklskeeraarvaakiaalagqq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vxvF (F:)
    msaqkapkwypsedvaalkktrkaarpqklraslvpgtvlillagrfrgkrvvylkhled
    ntllisgpfkvngvplrrvnaryviatstkvsvegvnvekfnveyfakekltkkekkean
    lfpeqqnkeikaervedqkvvdkaliaeikktpllkqylsasfslkngdkphmlkf
    

    Sequence, based on observed residues (ATOM records):
    >1vxvF (F:)
    saqkapkwypsedvaalkktrkaarpqklraslvpgtvlillagrfrgkrvvylkhledn
    tllisgpfkvngvplrrvnaryviatstkvsvegvnvekfnveyfakeeikaervedqkv
    vdkaliaeikktpllkqylsasfslkngdkphmlkf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vxvG (G:)
    maaekiltpesqlkkskaqqktaeqvaaeraarkaankekraiilernaayqkeyetaer
    niiqakrdakaagsyyveaqhklvfvvrikginkippkprkvlqllrltrinsgtfvkvt
    katlellkliepyvaygypsystirqlvykrgfgkinkqrvplsdnaiieanlgkygils
    iddliheiitvgphfkqannflwpfklsnpsggwgvprkfkhfiqggsfgnreefinklv
    ksmn
    

    Sequence, based on observed residues (ATOM records):
    >1vxvG (G:)
    aeqvaaeraarkaankekraiilernaayqkeyetaerniiqakrdakaagsyyveaqhk
    lvfvvrikginkippkprkvlqllrltrinsgtfvkvtkatlellkliepyvaygypsys
    tirqlvykrgfgkinkqrvplsdnaiieanlgkygilsiddliheiitvgphfkqannfl
    wpfklsnpsggwgvprkfkhfiqggsfgnreefinklvksmn
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vxvH (H:)
    mapgkkvapapfgakstksnktrnplthstpknfgigqavqpkrnlsryvkwpeyvrvqr
    qkkilsirlkvpptiaqfqytldrntaaetfklfnkyrpetaaekkerltkeaaavaegk
    skqdaspkpyavkyglnhvvalienkkaklvliandvdpielvvflpalckkmgvpyaiv
    kgkarlgtlvnqktsavaaltevraedeaalaklvstidanfadkydevkkhwgggilgn
    kaqakmdkraknsdsa
    

    Sequence, based on observed residues (ATOM records):
    >1vxvH (H:)
    nplthstpknfgigqavqpkrnlsryvkwpeyvrvqrqkkilsirlkvpptiaqfqytld
    rntaaetfklfnkyrpetaaekkerltkeaaavaegkskqdaspkpyavkyglnhvvali
    enkkaklvliandvdpielvvflpalckkmgvpyaivkgkarlgtlvnqktsavaaltev
    raedeaalaklvstidanfadkydevkkhwgggilgnkaqakmdkraknsdsa
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1vxvI (I:)
    mkyiqteqqievpegvtvsiksrivkvvgprgtltknlkhidvtftkvnnqlikvavhng
    grkhvaalrtvkslvdnmitgvtkgykykmryvyahfpinvnivekdgakfievrnflgd
    kkirnvpvrdgvtiefstnvkdeivlsgnsvedvsqnaadlqqicrvrnkdirkfldgiy
    vshkgfitedl
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vxvJ (J:)
    marrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleql
    ssealeaaricankymttvsgrdafhlrvrvhpfhvlrinkmlscagadrlqqgmrgawg
    kphglaarvdigqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpe
    ylkkreagevkddgafvkflskkgslennirefpeyfaaqa
    

    Sequence, based on observed residues (ATOM records):
    >1vxvJ (J:)
    arrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqls
    sealeaaricankymttvsgrdafhlrvrvhpfhvlrinkmqqgmrgawgkphglaarvd
    igqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagev
    kddgafvkflskkgslennirefpeyfaaqa
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vxvK (K:)
    msakaqnpmrdlkieklvlnisvgesgdrltraskvleqlsgqtpvqskarytvrtfgir
    rnekiavhvtvrgpkaeeilerglkvkeyqlrdrnfsatgnfgfgidehidlgikydpsi
    gifgmdfyvvmnrpgarvtrrkrckgtvgnshkttkedtvswfkqkydadvldk
    

    Sequence, based on observed residues (ATOM records):
    >1vxvK (K:)
    qnpmrdlkieklvlnisvgesgdrltraskvleqlsgqtpvqskarytvrtfgirrneki
    avhvtvrgpkaeeilerglkvkeyqlrdrnfsatgnfgfgidehidlgikydpsigifgm
    dfyvvmnrpgarvtrrkrckgtvgnshkttkedtvswfkqkydadvldk
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vxvL (L:)
    mppkfdpnevkylylravggevgasaalapkigplglspkkvgediakatkefkgikvtv
    qlkiqnrqaaasvvpsasslvitalkepprdrkkdknvkhsgniqldeiieiarqmrdks
    fgrtlasvtkeilgtaqsvgcrvdfknphdiieginageieipen
    

    Sequence, based on observed residues (ATOM records):
    >1vxvL (L:)
    evkylylravggevglapkigplglspkkvgediakatkekgikvtvqlkiqnrqaaasv
    vpsasslvitalkepprdrkkdknvkhsgniqldeiieiarqmrdksfgrtlasvtkeil
    gtaqsvgcrvdfknphdiieginageieip
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vxvM (M:)
    maisknlpilknhfrkhwqervkvhfdqagkkvsrrnaratraakiaprpldllrpvvra
    ptvkynrkvragrgftlaevkaagltaayartigiavdhrrqnrnqeifdanvqrlkeyq
    skiivfprngkapeaeqvlsaaatfpiaqpatdvearavqdngesafrtlrlarsekkfr
    girekrarekaeaeaekkk
    

    Sequence, based on observed residues (ATOM records):
    >1vxvM (M:)
    aisknlpilknhfrkhwqervkvhfdqagkkvsrrnaratraakiaprpldllrpvvrap
    tvkynrkvragrgftlaevkaagltaayartigiavdhrrqnrnqeifdanvqrlkeyqs
    kiivfprngkapeaeqvlsaaatfpiaqpatdvearavqdngesafrtlrlarsekkfrg
    irekrarekaeae
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vxvN (N:)
    mstdsivkasnwrlvevgrvvlikkgqsagklaaiveiidqkkvlidgpkagvprqainl
    gqvvltpltfalprgartatvskkwaaaavcekwaasswakkiaqrerraaltdferfqv
    mvlrkqkrytvkkalaka
    

    Sequence, based on observed residues (ATOM records):
    >1vxvN (N:)
    tdsivkasnwrlvevgrvvlikkgqsagklaaiveiidqkkvlidgpkagvprqainlgq
    vvltpltfalprgartatvskkwaaaavcekwaasswakkiaqrerraaltdferfqvmv
    lrkqkrytvkkalaka
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vxvO (O:)
    mgaykyleelqrkkqsdvlrflqrvrvweyrqknvihraarptrpdkarrlgykakqgfv
    iyrvrvrrgnrkrpvpkgatygkptnqgvnelkyqrslrataeervgrraanlrvlnsyw
    vnqdstykyfevilvdpqhkairrdarynwicdpvhkhreargltatgkksrginkghkf
    nntkagrrktwkrqntlslwryrk
    

    Sequence, based on observed residues (ATOM records):
    >1vxvO (O:)
    gaykyleelqrkkqsdvlrflqrvrvweyrqknvihraarptrpdkarrlgykakqgfvi
    yrvrvrrgnrkrpvpkgatygkptnqgvnelkyqrslrataeervgrraanlrvlnsywv
    nqdstykyfevilvdpqhkairrdarynwicdpvhkhreargltatgkksrginkghkfn
    ntkagrrktwkrqntlslwryrk
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vxvP (P:)
    msvepvvvidgkghlvgrlasvvakqllngqkivvvraeelnisgeffrnklkyhdflrk
    atafnktrgpfhfrapsrifykalrgmvshktargkaalerlkvfegipppydkkkrvvv
    pqalrvlrlkpgrkyttlgklstsvgwkyedvvakleakrkvssaeyyakkraftkkvas
    anataaesdvakqlaalgy
    

    Sequence, based on observed residues (ATOM records):
    >1vxvP (P:)
    vepvvvidgkghlvgrlasvvakqllngqkivvvraeelnisgeffrnklkyhdflrkat
    afnktrgpfhfrapsrifykalrgmvshktargkaalerlkvfegipppydkkkrvvvpq
    alrvlrlkpgrkyttlgklstsvgwkyedvvakleakrkvssaeyyakkraftkkvasan
    ataaesdvakqlaalgy
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vxvQ (Q:)
    marygatstnpaksasargsylrvsfkntretaqaingweltkaqkyleqvldhqraipf
    rrfnssigrtaqgkefgvtkarwpaksvkfvqgllqnaaanaeakgldatklyvshiqvn
    qapkqrrrtyrahgrinkyesspshielvvtekeeavakaaekkvvrltsrqrgriaaqk
    riaa
    

    Sequence, based on observed residues (ATOM records):
    >1vxvQ (Q:)
    arygatstnpaksasargsylrvsfkntretaqaingweltkaqkyleqvldhqraipfr
    rfnssigrtaqgkefgvtkarwpaksvkfvqgllqnaaanaeakgldatklyvshiqvnq
    apkqrrrtyrahgrinkyesspshielvvtekeeavakaaekkvvrltsrqrgriaaqkr
    iaa
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vxvR (R:)
    mgidhtskqhkrsghrtapksdnvylkllvklytflarrtdapfnkvvlkalflskinrp
    pvsvsriaralkqegaanktvvvvgtvtddarifefpkttvaalrftagarakivkagge
    citldqlavrapkgqntlilrgprnsreavrhfgmgphkgkaprilstgrkferargrrr
    skgfkv
    

    Sequence, based on observed residues (ATOM records):
    >1vxvR (R:)
    gidhtskqhkrsghrtapksdnvylkllvklytflarrtdapfnkvvlkalflskinrpp
    vsvsriaralkqegaanktvvvvgtvtddarifefpkttvaalrftagarakivkaggec
    itldqlavrapkgqntlilrgprnsreavrhfgmgphkgkaprilstgrkferargrrrs
    kgfkv
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vxvS (S:)
    manlrtqkrlaasvvgvgkrkvwldpnetseiaqansrnairklvkngtivkkavtvhsk
    srtrahaqskregrhsgygkrkgtrearlpsqvvwirrlrvlrrllakyrdagkidkhly
    hvlykeskgnafkhkralvehiiqakadaqrekalneeaearrlknraardrraqrvaek
    rdallkeda
    

    Sequence, based on observed residues (ATOM records):
    >1vxvS (S:)
    anlrtqkrlaasvvgvgkrkvwldpnetseiaqansrnairklvkngtivkkavtvhsks
    rtrahaqskregrhsgygkrkgtrearlpsqvvwirrlrvlrrllakyrdagkidkhlyh
    vlykeskgnafkhkralvehiiqakadaqrekalneeaearrlknraardrraqrvaekr
    dallkeda
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1vxvT (T:)
    mahfkeyqvigrrlptesvpepklfrmrifasneviaksrywyflqklhkvkkasgeivs
    inqineahptkvknfgvwvrydsrsgthnmykeirdvsrvaavetlyqdmaarhrarfrs
    ihilkvaeiektadvkrqyvkqfltkdlkfplphrvqkstktfsykrpstfy
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vxvU (U:)
    mgkshgyrsrtrymfqrdfrkhgavhlstylkvykvgdivdikangsiqkgmphkfyqgk
    tgvvynvtkssvgviinkmvgnrylekrlnlrvehikhskcrqeflervkanaakraeak
    aqgvavqlkrqpaqpresrivstegnvpqtlapvpyetfi
    

    Sequence, based on observed residues (ATOM records):
    >1vxvU (U:)
    gkshgyrsrtrymfqrdfrkhgavhlstylkvykvgdivdikangsiqkgmphkfyqgkt
    gvvynvtkssvgviinkmvgnrylekrlnlrvehikhskcrqeflervkanaakraeaka
    qgvavqlkrqpaqpresrivstegnvpqtlapvpyetfi
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vxvV (V:)
    mapntsrkqkiaktftvdvssptengvfdpasyakylidhikvegavgnlgnavtvtedg
    tvvtvvstakfsgkylkyltkkylkknqlrdwirfvstktneyrlafyqvtpeedeeede
    e
    

    Sequence, based on observed residues (ATOM records):
    >1vxvV (V:)
    qkiaktftvdvssptengvfdpasyakylidhikvegavgnlgnavtvtedgtvvtvvst
    akfsgkylkyltkkylkknqlrdwirfvstktneyrlafy
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vxvW (W:)
    msgngaqgtkfrislglpvgaimncadnsgarnlyiiavkgsgsrlnrlpaaslgdmvma
    tvkkgkpelrkkvmpaivvrqakswrrrdgvflyfednagvianpkgemkgsaitgpvgk
    ecadlwprvasnsgvvv
    

    Sequence, based on observed residues (ATOM records):
    >1vxvW (W:)
    sgngaqgtkfrislglpvgaimncadnsgarnlyiiavkgsgsrlnrlpaaslgdmvmat
    vkkgkpelrkkvmpaivvrqakswrrrdgvflyfednagvianpkgemkgsaitgpvgke
    cadlwprvasnsgvvv
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vxvX (X:)
    mkveidsfsgakiypgrgtlfvrgdskifrfqnsksaslfkqrknprriawtvlfrkhhk
    kgiteevakkrsrktvkaqrpitgasldlikerrslkpevrkanreeklkankekkkaek
    aarkaekaksagtqsskfskqqakgafqkvaatsr
    

    Sequence, based on observed residues (ATOM records):
    >1vxvX (X:)
    mkveidsfsgakiypgrgtlfvrgdskifrfqnsksaslfkqrknprriawtvlfrkhhk
    kgiteevakkrsrktvkaqrpitgasldlikerrslkpevrkanreeklkankekkkaek
    aarkaekaksagtqs
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vxvY (Y:)
    mapsakataakkavvkgtngkkalkvrtsatfrlpktlklarapkyaskavphynrldsy
    kvieqpitsetamkkvedgnilvfqvsmkankyqikkavkelyevdvlkvntlvrpngtk
    kayvrltadydaldianrigyi
    

    Sequence, based on observed residues (ATOM records):
    >1vxvY (Y:)
    kalkvrtsatfrlpktlklarapkyaskavphynrldsykvieqpitsetamkkvedgni
    lvfqvsmkankyqikkavkelyevdvlkvntlvrpngtkkayvrltadydaldianrigy
    i
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vxvZ (Z:)
    makqsldvssdrrkarkayftapssqrrvllsaplskelraqygikalpirrddevlvvr
    gskkgqegkissvyrlkfavqvdkvtkekvngasvpinlhpsklvitklhldkdrkaliq
    rkggkle
    

    Sequence, based on observed residues (ATOM records):
    >1vxvZ (Z:)
    akqsldvssdrrkarkayftapssqrrvllsaplskelraqygikalpirrddevlvvrg
    skkgqegkissvyrlkfavqvdkvtkekvngasvpinlhpsklvitklhldkdrkaliqr
    kggkle
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >1vxva (a:)
    makflkagkvavvvrgryagkkvvivkphdegskshpfghalvagieryplkvtkkhgak
    kvakrtkikpfikvvnynhllptrytldveafksvvstetfeqpsqreeakkvvkkafee
    rhqagknqwffsklrf
    

    Sequence, based on observed residues (ATOM records):
    >1vxva (a:)
    akflkagkvavvvrgryagkkvvivkphdegskshpfghalvagieryplkvtkkhgakk
    vakrtkikpfikvvnynhllptrytldveafksvvstetfeqpsqreeakkvvkkafeer
    hqagknqwffsklrf
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >1vxvb (b:)
    mpsrftktrkhrghvsagkgrigkhrkhpggrgmaggqhhhrinmdkyhpgyfgkvgmry
    fhkqqahfwkpvlnldklwtlipedkrdqylksasketapvidtlaagygkilgkgripn
    vpvivkarfvsklaeekiraaggvvelia
    

    Sequence, based on observed residues (ATOM records):
    >1vxvb (b:)
    psrftktrkhrghvsagkgrigkhrkhpggrgmaggqhhhrinmdkyhpgyfgkvgmryf
    hkqqahfwkpvlnldklwtlipedkrdqylksasketapvidtlaagygkilgkgripnv
    pvivkarfvsklaeekiraaggvvelia
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1vxvc (c:)
    maksknhtahnqtrkahrngikkpktykypslkgvdpkfrrnhkhalhgtakalaaakk
    

    Sequence, based on observed residues (ATOM records):
    >1vxvc (c:)
    aksknhtahnqtrkahrngikkpktykypslkgvdpkfrrnhkhalhgtakalaaakk
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1vxvd (d:)
    mapvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyya
    mlsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
    

    Sequence, based on observed residues (ATOM records):
    >1vxvd (d:)
    sinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyamlsktkvy
    yfqggnnelgtavgklfrvgvvsileagdsdilttla
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1vxve (e:)
    maglkdvvtreytinlhkrlhgvsfkkrapravkeikkfaklhmgtddvrlapelnqaiw
    krgvkgveyrlrlrisrkrneeedaknplfsyvepvlvasakglqtvvveeda
    

    Sequence, based on observed residues (ATOM records):
    >1vxve (e:)
    lkdvvtreytinlhkrlhgvsfkkrapravkeikkfaklhmgtddvrlapelnqaiwkrg
    vkgveyrlrlrisrkrneeedaknplfsyvepvlvasakglqtvvveed
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1vxvf (f:)
    maslphpkivkkhtkkfkrhhsdryhrvaenwrkqkgidsvvrrrfrgnisqpkigygsn
    kktkflspsghktflvanvkdletltmhtktyaaeiahnisaknrvvilarakalgikvt
    npkgrlalea
    

    Sequence, based on observed residues (ATOM records):
    >1vxvf (f:)
    aslphpkivkkhtkkfkrhhsdryhrvaenwrkqkgidsvvrrrfrgnisqpkigygsnk
    ktkflspsghktflvanvkdletltmhtktyaaeiahnisaknrvvilarakalgikvtn
    pkgrlal
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >1vxvg (g:)
    maeshrlyvkgkhlsyqrskrvnnpnvslikiegvatpqdaqfylgkriayvyraskevr
    gskirvmwgkvtrthgnsgvvratfrnnlpaktfgasvriflypsni
    

    Sequence, based on observed residues (ATOM records):
    >1vxvg (g:)
    aeshrlyvkgkhlsyqrskrvnnpnvslikiegvatpqdaqfylgkriayvyraskevrg
    skirvmwgkvtrthgnsgvvratfrnnlpaktfgasvriflypsni
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1vxvh (h:)
    maqrvtfrrrnpyntrsnkikvvktpggilraqhvkklatrpkcgdcgsalqgistlrpr
    qyatvskthktvsrayggsrcancvkeriiraflieeqkivkkvvkeqteaakksekkak
    k
    

    Sequence, based on observed residues (ATOM records):
    >1vxvh (h:)
    aqrvtfrrrnpyntrsnkikvvktpggilraqhvkklatrpkcgdcgsalqgistlrprq
    yatvskthktvsrayggsrcancvkeriiraflieeqkivkkvvkeqteaak
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >1vxvi (i:)
    magvkayelrtkskeqlasqlvdlkkelaelkvqklsrpslpkiktvrksiacvltvine
    qqreavrqlykgkkyqpkdlrakktralrraltkfeasqvtekqrkkqiafpqrkyaika
    

    Sequence, based on observed residues (ATOM records):
    >1vxvi (i:)
    agvkayelrtkskeqlasqlvdlkkelaelkvqklsrpslpkiktvrksiacvltvineq
    qreavrqlykgkkyqpkdlrakktralrraltkfeasqvtekqrkkqiafpqrkyaika
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >1vxvj (j:)
    mtvktgiaiglnkgkkvtsmtpapkisykkgaasnrtkfvrslvreiaglspyerrlidl
    irnsgekrarkvakkrlgsftrakakveemnniiaasrrh
    

    Sequence, based on observed residues (ATOM records):
    >1vxvj (j:)
    tvktgiaiglnkgkkvtsmtpapkisykkgaasnrtkfvrslvreiaglspyerrlidli
    rnsgekrarkvakkrlgsftrakakveemnniiaasrrh
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >1vxvk (k:)
    mgkgtpsfgkrhnkshtlcnrcgrrsfhvqkktcsscgypaaktrsynwgakakrrhttg
    tgrmrylkhvsrrfkngfqtgsaskasa
    

    Sequence, based on observed residues (ATOM records):
    >1vxvk (k:)
    gkgtpsfgkrhnkshtlcnrcgrrsfhvqkktcsscgypaaktrsynwgakakrrhttgt
    grmrylkhvsrrfkngfqtgsaskasa
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >1vxvl (l:)
    mareitdikqfleltrradvktatvkinkklnkagkpfrqtkfkvrgssslytlvindag
    kakkliqslpptlkvnrl
    

    Sequence, based on observed residues (ATOM records):
    >1vxvl (l:)
    areitdikqfleltrradvktatvkinkklnkagkpfrqtkfkvrgssslytlvindagk
    akkliqslpptlkvnrl
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >1vxvm (m:)
    maaqksfrikqkmakakkqnrplpqwirlrtnntirynakrrnwrrtkmni
    

    Sequence, based on observed residues (ATOM records):
    >1vxvm (m:)
    aaqksfrikqkmakakkqnrplpqwirlrtnntirynakrrnwrrtkmni
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >1vxvn (n:)
    mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggiiepslkalaskyncdksvcrkcyarlppratncrkrkcghtnq
    lrpkkklk
    

    Sequence, based on observed residues (ATOM records):
    >1vxvn (n:)
    iiepslkalaskyncdksvcrkcyarlppratncrkrkcghtnqlrpkkklk
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1vxvo (o:)
    mrakwrkkrtrrlkrkrrkvrarsk
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >1vxvp (p:)
    mvnvpktrktyckgktcrkhtqhkvtqykagkaslfaqgkrrydrkqsgfggqtkpvfhk
    kakttkkvvlrlecvkcktraqltlkrckhfelggekkqkgqalqf
    

    Sequence, based on observed residues (ATOM records):
    >1vxvp (p:)
    vnvpktrktyckgktcrkhtqhkvtqykagkaslfaqgkrrydrkqsgfggqtkpvfhkk
    akttkkvvlrlecvkcktraqltlkrckhfelggekkqkgqalqf
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >1vxvq (q:)
    makrtkkvgitgkygvrygsslrrqvkkleiqqharydcsfcgkktvkrgaagiwtcscc
    kktvaggaytvstaaaatvrstirrlremvea
    

    Sequence, based on observed residues (ATOM records):
    >1vxvq (q:)
    akrtkkvgitgkygvrygsslrrqvkkleiqqharydcsfcgkktvkrgaagiwtcscck
    ktvaggaytvstaaaatvrstirrlremvea
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >1vxvr (r:)
    mggirekkaeyfaklreyleeykslfvvgvdnvssqqmhevrkelrgravvlmgkntmvr
    rairgflsdlpdfekllpfvkgnvgfvftneplteiknvivsnrvaaparagavapediw
    vravntgmepgktsffqalgvptkiargtieivsdvkvvdagnkvgqseasllnllnisp
    ftfgltvvqvydngqvfpssilditdeelvshfvsavstiasislaigyptlpsvghtli
    nnykdllavaiaasyhypeiedlvdrienpekyaaaapaatsaasgdaapaeeaaaeeee
    esdddmgfglfd
    

    Sequence, based on observed residues (ATOM records):
    >1vxvr (r:)
    girekkaeyfaklreyleeykslfvvgvdnvssqqmhevrkelrgravvlmgkntmvrra
    irgflsdlpdfekllpfvkgnvgfvftneplteiknvivsnrvaagltvvqvydngqvfp
    s
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >1vxvs (s:)
    masnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrs
    fkghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkas
    miisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvka
    wnlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdev
    fslafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqt
    lfagytdnvirvwqvmtan
    

    Sequence, based on observed residues (ATOM records):
    >1vxvs (s:)
    asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
    kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
    iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
    nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
    slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
    fagytdnvirvwqvmtan