PDB entry 1vxf

View 1vxf on RCSB PDB site
Description: native sperm whale myoglobin
Class: oxygen storage
Keywords: sperm whale myoglobin, ph values, conformational changes, oxygen storage
Deposited on 1996-01-09, released 1996-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.146
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vxfa_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vxfA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg