PDB entry 1vxb

View 1vxb on RCSB PDB site
Description: native sperm whale myoglobin
Deposited on 1996-01-09, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1vxb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vxb_ (-)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg