PDB entry 1vx7

View 1vx7 on RCSB PDB site
Description: Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine, large subunit (protein only)
Deposited on 2014-06-02, released 2014-07-16
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 60S ribosomal protein eL24
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '1':
    Compound: 60S ribosomal protein eL27
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 60S ribosomal protein eL28
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 60s ribosomal protein ul29
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 60S ribosomal protein eL29
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 60S ribosomal protein uL30
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: 60S ribosomal protein eL30
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: 60S ribosomal protein eL31
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: 60S ribosomal protein eL32
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain '9':
    Compound: 60S ribosomal protein eL33
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 60S ribosomal protein uL2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 60S ribosomal protein uL3
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 60S ribosomal protein uL4
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 60S ribosomal protein uL5
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 60S ribosomal protein uL6
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 60S ribosomal protein eL6
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 60S ribosomal protein eL8
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 60S ribosomal protein uL13
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 60S ribosomal protein eL13
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 60S ribosomal protein uL14
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 60S ribosomal protein eL14
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 60S ribosomal protein uL15
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 60S ribosomal protein eL15
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 60S ribosomal protein uL16
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 60S ribosomal protein uL18
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 60S ribosomal protein eL18
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 60S ribosomal protein eL19
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 60S ribosomal protein eL20
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 60S ribosomal protein eL21
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 60S ribosomal protein uL22
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 60S ribosomal protein eL22
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 60S ribosomal protein uL23
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 60S ribosomal protein uL24
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: 60S ribosomal protein eL34
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 60S ribosomal protein eL36
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: 60S ribosomal protein eL37
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: 60S ribosomal protein eL38
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: 60S ribosomal protein eL39
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 60S ribosomal protein eL40
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: 60S ribosomal protein eL41
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: 60S ribosomal protein eL43
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: 60S ribosomal protein eL44
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence, based on SEQRES records:
    >1vx70 (0:)
    msqikttvkteacsfseyriypgrgqkyiardgkvyfylsskfaslalqkkkaaklrwtq
    twrrnnkktkiettqrrrykktikvqkavcgltvedirnrkayvqsieaknkakfgtkek
    edkkktkddkkknlvhfqqkkdftkskmlnmakskmhkmmkk
    

    Sequence, based on observed residues (ATOM records):
    >1vx70 (0:)
    vkteacsfseyriypgrgqkyiardgkvyfylsskfaslalqkkkaaklrwtqtwrrnnk
    kt
    

  • Chain '1':
    Sequence, based on SEQRES records:
    >1vx71 (1:)
    mgkllkpgkviiilngrragkkavivntyegqtrerpysyclvagiekhplkvnksmtkk
    kivkrskvkafikcinvnhilptryqvandfdikslasddvlksknkkkevkklgkifrd
    kflepvnkktgevskdisflhkklyf
    

    Sequence, based on observed residues (ATOM records):
    >1vx71 (1:)
    gkllkpgkviiilngrragkkavivntyegqtrerpysyclvagiekhplkvnksmtkkk
    ivkrskvkafikcinvnhilptryqvandfdikslasddvlksknkkkevkklgkifrdk
    flepvevskdisflhkklyf
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1vx72 (2:)
    msnvsnalvweltrksncfikknkagkkgvflcdplnvnykntpsssglvksnstnvtlk
    dgkvvfsvktskesnvvnqhfkaknmknvekllqqhgsfekaknkekllkkykrlsklye
    tshkktn
    

    Sequence, based on observed residues (ATOM records):
    >1vx72 (2:)
    snvsnalvweltrksncfikknkagkkgvflcdplnvnykntpsssglvksnstnvtlkd
    gkvvfsvkvnqhfkmknvekllqqhgsknkekllkkykrlskly
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1vx73 (3:)
    msnvkayelrtlkkkelldkldelkkelsglriskalgnsaknskihgvrknvarvltvy
    nqkrkmelrqlyknkkfkpynlrkkltknkrlqlspkqkaamtlrqkkkvqnfpqrkylv
    vhke
    

    Sequence, based on observed residues (ATOM records):
    >1vx73 (3:)
    nvkayelrtlkkkelldkldelkkelsglriskalgnsaknskihgvrknvarvltvynq
    krkmelrqlyknkkfkpynlrkkltknkrlqlspkqkaamtlrqkkkvqnfpqrkylvv
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >1vx74 (4:)
    maksknhtnhnqnrkahkngikkpkkhkfmsrkgldpnffrnqkyclkgiqkkkkelklk
    akqeknn
    

    Sequence, based on observed residues (ATOM records):
    >1vx74 (4:)
    aksknhtnhnqnrkahkngikkpkkhkfmsrkgldpnffrnqkyclkgiqkkkkelklka
    kqeknn
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >1vx75 (5:)
    madryenqvenelgksmtslrakkvnknkelkqaaakkiktlklinkkkrndlrqrtlry
    eeeyeserkkiielkrearknncfyreaekkvvfvirlkgvnklppkvrsvfrllrllqv
    hngvfvkvnkatkemlkivepyvtygyptlstvrkllykrgyvrvgkvrryarkkiqdna
    diskhlgkynvhgiedmvyqlytcgpvfkkvnnflwafklkpprkgfkakrhafneprpg
    dwgnreahinelinrmi
    

    Sequence, based on observed residues (ATOM records):
    >1vx75 (5:)
    aakkiktlklinkkkrndlrqrtlryeeeyeserkkiielkrearknncfyreaekkvvf
    virlkgvnklppkvrsvfrllrllqvhngvfvkvnkatkemlkivepyvtygyptlstvr
    kllykrgyvrvgkvrryarkkiqdnadiskhlgkynvhgiedmvyqlytcgpvfkkvnnf
    lwafklkpprkgfkakrhafneprpgdwgnreahinelinrmi
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >1vx76 (6:)
    makkskksagdninaklqlvmksgkyqfgrksclkalrtgkgklvivssncpsiqrsvie
    yyamlskcgvhdyhgdnndlgtacgklfrisclvitdvgdsdiiktne
    

    Sequence, based on observed residues (ATOM records):
    >1vx76 (6:)
    sagdninaklqlvmksgkyqfgrksclkalrtgkgklvivssncpsiqrsvieyyamlsk
    cgvhdyhgdnndlgtacgklfrisclvitdvgdsdiik
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >1vx77 (7:)
    mvkgtvkkqkktlkpvtkfitinlsklthkvcykrkapraikeirsiagklmhtkdvrld
    vklnkfiwskgvrnppkrvrvklerkrnededskekmytivehvmvdsykglvneceane
    

    Sequence, based on observed residues (ATOM records):
    >1vx77 (7:)
    pvtkfitinlsklthkvcykrkapraikeirsiagklmhtkdvrldvklnkfiwskgvrn
    ppkrvrvklerkrnekmytivehvmvdsykglvnec
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >1vx78 (8:)
    mavkkvgkiikkrtkkftrfqsnrfmrvkpawrkprgidcrvrrrykgtnlmpsigygsn
    kktkfllpnnkykyvvknvkemeplimnhtkycvqiahnvsskkrkqiierakqmnvsvi
    nakarlqktee
    

    Sequence, based on observed residues (ATOM records):
    >1vx78 (8:)
    avkkvgkiikkrtkkftrfqsnrfmrvkpawrkprgidcrvrrrykgtnlmpsigygsnk
    ktkfllpnnkykyvvknvkemeplimnhtkycvqiahnvsskkrkqiierakqmnvsvin
    akarl
    

  • Chain '9':
    Sequence, based on SEQRES records:
    >1vx79 (9:)
    menvkvkkeqtevsqkkkvvkkvlkknkktsnkklqavrlyekgvilgykrsqrnqdpnf
    tlisiknvntkkhaqfyvgkrvayvyrttkhhdgvkikciwgkvcrthgnsgvirakfkt
    hippkafgdrvrilmypsni
    

    Sequence, based on observed residues (ATOM records):
    >1vx79 (9:)
    lqavrlyekgvilgykrsqrnqdpnftlisiknvntkkhaqfyvgkrvayvyrttkhhdg
    vkikciwgkvcrthgnsgvirakfkthippkafgdrvrilmyp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vx7D (D:)
    mgrvirgqrkgrgsifkshnhhrkgaaklrhldycekkgyikglvkdiihdpgrgaplak
    vifkrtekygkkeeliiasegmftgqyiscgtkaplsvgnilpigkmpegtlicnlehrt
    gnrgtlvkasgcyatvvgqsedgkktkvrlpsgakktidakaramvgvvgaggridkpil
    kagvahhkyrvkrncwpkvrgvamnpvehphgggnhqhighpstvsrsapagqkvgliaa
    rrtgllrgakktklvgksee
    

    Sequence, based on observed residues (ATOM records):
    >1vx7D (D:)
    grvirgqrkgrgsifkshnhhrkgaaklrhldycekkgyikglvkdiihdpgrgaplakv
    ifkrtekygkkeeliiasegmftgqyiscgtkaplsvgnilpigkmpegtlicnlehrtg
    nrgtlvkasgcyatvvgqsedgkktkvrlpsgakktidakaramvgvvgaggridkpilk
    agvahhkyrvkrncwpkvrgvamnpvehphgggnhqhighpstvsrsapagqkvgliaar
    rtgllrg
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vx7E (E:)
    mshrkferprhgslgflprkrckrlrgkirsfpkddkekpphftafmgykagmthivrev
    dkpgsklhkkeiveactiiecapmvvvgivgyretpkglrilstvwanhvsdefrrryyk
    nwyksekkaftkslnvpeatkncllkriekyctvlraichtqpsktplrmkkahimevqi
    nggsmkeklefvkemleknlpvstvfnpnemidvisvtkghgtkgvvsrygvkrlprkth
    rglrkvacigawhparvqfqiprhgqkgyfhrternkkiyriglktdknsastdaditek
    kitpmggfphygvvnedflllkgcvagtkkrpitlrknivpqvsrdalaqvslkfidtss
    kighgrfqtseekvkyygplkkdlka
    

    Sequence, based on observed residues (ATOM records):
    >1vx7E (E:)
    shrkferprhgslgflprkrckrlrgkirsfpkddkekpphftafmgykagmthivrevd
    kpgsklhkkeiveactiiecapmvvvgivgyretpkglrilstvwanhvsdefrrryykn
    wyksekkaftkslnvpeatkncllkriekyctvlraichtqpsktplrmkkahimevqin
    ggsmkeklefvkemleknlpvstvfnpnemidvisvtkghgtkgvvsrygvkrlprkthr
    glrkvacigawhparvqfqiprhgqkgyfhrternkkiyriglktdknsastdaditekk
    itpmggfphygvvnedflllkgcvagtkkrpitlrknivpqvsrdalaqvslkfidtssk
    ighgrfqtseekvkyygplk
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vx7F (F:)
    matirpvanvystngknvvgeveipvvfqtpirndliqsvytnmsknrrhpyavklgagy
    etsaeswgtgravariprvpgggthragqgafgnmcrgggmfnptkiwrrwgrkvnlkek
    ryavcssiaasgvtslvlarghrishlkevplvvsndieslsktkeavnflvslglkdev
    nrlvkskkiragkgkmrnrkykirngpliiyendngvkkafrnipgvdlckvtklnllkl
    apggsigrlciwsesafkkldviygkihekkvtkknyilpksivhnpdiyriihsdkvqa
    sllakkkpckkrlqnknsltnfavrcrlnpaykllrslavlrmrksileksknkkekrvq
    kqiqkkelqkinhdyykgvakavkkkkkreekkakskktanqavinvaaee
    

    Sequence, based on observed residues (ATOM records):
    >1vx7F (F:)
    pvanvystngknvvgeveipvvfqtpirndliqsvytnmsknrrhpyavklgagyetsae
    swgtgravariprvpgggthragqgafgnmcrgggmfnptkiwrrwgrkvnlkekryavc
    ssiaasgvtslvlarghrishlkevplvvsndieslsktkeavnflvslglkdevnrlvk
    skkiragkgkmrnrkykirngpliiyendngvkkafrnipgvdlckvtklnllklapggs
    igrlciwsesafkkldviygkihekkvtkknyilpksivhnpdiyriihsdkvqasllak
    kkpckkrlqnknsltnfavrcrlnpaykllrslavlrmrksileksknkkekrvqkqiqk
    kelqkinhdyykgvakavkkkkkreekkak
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vx7G (G:)
    menkeqnvmreikvnklvlnicvgesgdrltraarvleqlteqkpifgkcrftirsfgvr
    rnekiscfvtvrgkkaleilekglkvkeyelrrknfsdtgnfgfgiqehidlgikydpst
    giygmdfyvhlsrsgyrvtrrtrrrskiskthkvtkedamkwfqtkfdgillk
    

    Sequence, based on observed residues (ATOM records):
    >1vx7G (G:)
    vmreikvnklvlnicvgesgdrltraarvleqlteqkpifgkcrkiscfvtvrgkkalei
    lekglkrrknfsdtgnfgfgigmdfyvhlsrsgyrvtrrtrrrskiskthkvtkedamkw
    fqtk
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vx7H (H:)
    mktivstqkvlipegvkvainarkvtvsgkygtlrrsfrhlpidirlnklkkyikvvmwf
    gvpdslacirtvcthlknmftgvtkkflykmrlvhahfpinsnivdnntrieirnylgek
    svrfvkalpgvviekspnvkdeiyvsgadienvsltaalihqsvlcrnkdirkfldgiyv
    sevttvekde
    

    Sequence, based on observed residues (ATOM records):
    >1vx7H (H:)
    ktivstqkvlipegvkvainarkvtvsgkygtlrrsfrhlpidirlnklkkyikvvmwfg
    vpdslacirtvcthlknmftgvtkkflykmrlvhahfpinsnivdnntrieirnylgeks
    vrfvkalpgvviekspnvkdeiyvsgadienvsltaalihqsvlcrnkdirkfldgiyvs
    evttv
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vx7I (I:)
    mtntsnelkhynvkgkkkvlvpvnakktinkkyfgrkvaskkkyvvqrklrksievgkva
    iiltgkhmgkrciitkilnsgllavvgpyeingvplkrvdsrylvvtstnifnfeniakl
    kddflnyaqdidddsfiktleikkkqkkllknknealfmnnvidkikeirkedpkvqkle
    giqkdigsllkpeilknkvfahylkskftlrndmvlhkmkf
    

    Sequence, based on observed residues (ATOM records):
    >1vx7I (I:)
    khynvkgkkkvlvpvnakktinkkyfgrkvaskkkyvvqrklrksievgkvaiiltgkhm
    gkrciitkilnsgllavvgpyeingvplkrvdsrylvvtstnifnfeniaklkddflnya
    qdidddsfiktleikkkqkkllkfmnnvidkikeirkedpkvqklegiqkdigsllkpei
    lknkvfahylkskftlrndmvlhkmkf
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vx7J (J:)
    makdkkqqkkpskktpapcplstkvtvkkeikkekktgikdnplifekkkrsniigvgvr
    pkkdlskyvkwpryiriqrkkkillqrlkvppsinqfnhtlpksqtqdllnflkaykpes
    ktdkkqrllnkakealnknitkdkkplflkyginhitklvenkkanlvviandvspielv
    lflpalcrlkevpycivkdkatlgklvhkktatavclesvkkedqekldyfakvckenfn
    dnvdlrrkwggqkmsaksmllkkmkdkarkieeakkkeisakl
    

    Sequence, based on observed residues (ATOM records):
    >1vx7J (J:)
    kdnplifekkkrsniigvgvrpkkdlskyvkwpryiriqrkkkillqrlkvppsinqfnh
    tlpksqtqdllnflkaykpesktdkkqrllnklflkyginhitklvenkkanlvviandv
    spielvlflpalcrlkevpycivkdkatlgklvhkktatavclesvkkedqekldyfakv
    ckenfndnvdlrrkwggqkmsaksmllkkmkdkarkieeakkkeisakl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vx7K (K:)
    mykkeyvidckghllgrlasliakellngqrivavrcedinisgslyrnklkyqeflrlr
    tntnpkkgplhlrepskilwrcvrgmlphktykgqlalkklkvcvgmpypydkkkkyvlp
    salrafrlkkhrrycrlgtlssrvgwnydtlvkknevlrkqvskayykkkvnnlnekkei
    ktealnlinpeqrqvlenfgya
    

    Sequence, based on observed residues (ATOM records):
    >1vx7K (K:)
    mykkeyvidckghllgrlasliakellngqrivavrcedinisgslyrnklkyqeflrlr
    tntnpkkgplhlrepskilwrcvrgmlphktykgqlalkklkvcvgmpypydkkkkyvlp
    salrafrlkkhrrycrlgtlssrvgwnydtlvkknevlrkqvskayykkkvnnlnekkei
    ktealnlinpeqrqvlenfgy
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vx7L (L:)
    mvahnnvlpnvhlhkwwqrhvrvnfsknikkkkrrllrekrrkanggtpieklhpivhcp
    tqrynfrtrlgkgftfeelkgagltpraaqtigicydkrrknrseesltknverllkykn
    slvmiplkknkakkgiggipadadkntikefrnkkpllsifkkekntkpfyetievskid
    keflayktlrraklaerrknrrqqkkdikfkskdn
    

    Sequence, based on observed residues (ATOM records):
    >1vx7L (L:)
    vahnnvlpnvhlhkwwqrhvrvnfsknikkkkrrllrekrrkanggtpieklhpivhcpt
    qrynfrtrlgkgftfeelkgagltpraaqtigicydkrrknrseesltknverllkykns
    lvmiplkknkakkgiggipadadkntikefrnkkpllsifkkekntkpfyetievskidk
    eflayktlrraklaerrknrrqqkkdikfks
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vx7M (M:)
    mkrgragtlknkmritlslpvgalinccdnsggknlyiiavqgfgsclnrlpaaslgdmv
    latvkkgkpdlrkkvlnaiicrqskawrrhegyyiyfednagvivnpkgemkgsaitgpv
    arecaelwpklssaasaiv
    

    Sequence, based on observed residues (ATOM records):
    >1vx7M (M:)
    tlknkmritlslpvgalinccdnsggknlyiiavqgfgsclnrlpaaslgdmvlatvkkg
    kpdlrkkvlnaiicrqskawrrhegyyiyfednagvivnpkgemkgsaitgpvarecael
    wpklssaasaiv
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vx7N (N:)
    mprvelteeeklyiskknllfkrfvepgrlclieygpyagklcfivdivtitrvivdgaf
    itgvprmviplkrlkllkerikinkncksgflrktvnstkvleefnnsklgkkmiikkkr
    deatdferfqvyfakrelkkkmttiknkkngenkkvkknvqkvka
    

    Sequence, based on observed residues (ATOM records):
    >1vx7N (N:)
    velteeelyiskknllfkrfvepgrlclieygpyagklcfivdivtitrvivdgafitgv
    prmviplkrlkllkerikinkncksgflrktvnstkvleefnnsklgkkmiikkkrdeat
    dferfqvyfakrelkkkmttiknkkn
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vx7O (O:)
    matrfkknrkkrghvsaghgrvgkhrkhpggrgkagglhhmrinfdkyhpgyfgkvgmrh
    lnllknrtycptinvdklwgllpeekkkefsenkdiapvidvtrkgyfkvlgngklkhnq
    pivvkaryfssvaekkikavggqcilva
    

    Sequence, based on observed residues (ATOM records):
    >1vx7O (O:)
    atrfkknrkkrghvsaghgrvgkhrkhpggrgkagglhhmrinfdkyhpgyfgkvgmrhl
    nllknrtycptinvdklwgllpeekkkefsenkdiapvidvtrkgyfkvlgngklkhnqp
    ivvkaryfssvaekkikavggqcilva
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vx7P (P:)
    mgaykyiqeiwkkkqsdamhfllrvrtweyrqlpvvhrvskpsrpdkarrlgykaiqgfv
    iyrvrvrrgdrkkrvkkgivhgkpkhqgvhkqkstrnlksvaegkvgksicgnlrvlnsy
    wvgqdavykyyevilvdpnhnavrnnpkinwicnpvhkhrelrgltsagkkyrglrvkgh
    lsaksrpsiranwkrrqliklrkcr
    

    Sequence, based on observed residues (ATOM records):
    >1vx7P (P:)
    gaykyiqeiwkkkqsdamhfllrvrtweyrqlpvvhrvskpsrpdkarrlgykaiqgfvi
    yrvrvrrgdrkkrvkkgivhgkpkhqgvhkqkstrnlksvaegkvgksicgnlrvlnsyw
    vgqdavykyyevilvdpnhnavrnnpkinwicnpvhkhrelrgltsagkkyrglrvkghl
    saksrpsiranwkrrqliklrkcr
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vx7Q (Q:)
    mgrrparcyrycknkpypksrycrgvpdpkiriydmgrkkadvnefsgvvhlvsyeyeqi
    ssealeaarisankymitncgkdnfhlrvrihpfhvlrinkmlscagadrlqtgmrgafg
    kpngvvarvdigqvllsirtkenfvskacealrrakykfpgrqkvfvsnkwgftpfskde
    yqqykkkgriisdgvsckfirekgpldkiykdintvles
    

    Sequence, based on observed residues (ATOM records):
    >1vx7Q (Q:)
    grrparcyrycknkpypksrycrgvpdpkiriydmgrkkadvnefsgvvhlvsyeyeqis
    sealeaarisankymitncgkdnfhlrvrihpfhvlrinkafgkpngvvarvdigqvlls
    irtkenfvskacealrrakykfpgrqkvfvsnkwgftpfskdeyqqykkkgriisdgvsc
    kfirekgpl
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vx7R (R:)
    mayvkvvknkayfkryqvkyrrrregktdyrarkalilqdknkynaqklrfvvrktnsqv
    icqiacahiegdkilaeakskelirygipvglknyaaayatgllcarrflkslnldtqfl
    gvekvtgeiennedkedeegrkpikafldvgitrtttgnrvfaalkgacdgglniphgnn
    rfpgsknefnpeqlrknilgihvaeymktlqeedndkykthfndylknnigaddieqmyl
    nahekirqnpekeskdtknvkkfvskhekpkklnaklrkkrvkeklalyveklq
    

    Sequence, based on observed residues (ATOM records):
    >1vx7R (R:)
    kvvknkayfkryqvkyrrrregktdyrarkalilqdknkynaqklrfvvrktnsqvicqi
    acahiegdkilaeakskelirygipvglknyaaayatgllcarrflkslnldtqflgvek
    vtrkpikafldvgitrtttgnrvfaalkgacdgglniphgnnrfpgsfnpeqlrknilgi
    hvaeymktlqeedndkykthfndylknnigaddieqmylnahekirqnpkklnaklrkkr
    vkeklalyvelq
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vx7S (S:)
    mgialknvgrikkhgrkhlvsknpylrllvklynflarrtnanfnkiiakrlimpkryrp
    plslsklqyhmanhpndiavvvgsitddkrlfslkqlkvcalrftetarkriedaggecl
    tfdqlalkyptgkkcvllrgptkartaekhfgkapgkpkskarpyvrskgrkfekargrr
    ksraykk
    

    Sequence, based on observed residues (ATOM records):
    >1vx7S (S:)
    gialknvgrikkhgrkhlvsknpylrllvklynflarrtnanfnkiiakrlimpkryrpp
    lslsklqyhmanhpndiavvvgsitddkrlfslkqlkvcalrftetarkriedaggeclt
    fdqlalkyptgkkcvllrgptkartaekhfgkapgkpkskarpyvrskgrkfekargrrk
    sraykk
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vx7T (T:)
    msltlqkrlaasvlkcgknkiwmdpneiseislansrfsirklykeglilkkpqkvhsra
    rvrlyklakrkgrhmgigkrkgtknartnqktlwikrqrvlrrllkrlrdskkvdrhlyh
    sfylkckgnqfknkrtlieaiqreknetlkkkaiadqleakrlkaqvlrnkrklkkdkev
    va
    

    Sequence, based on observed residues (ATOM records):
    >1vx7T (T:)
    sltlqkrlaasvlkcgknkiwmdpneiseislansrfsirklykeglilkkpqkvhsrar
    vrlyklakrkgrhmgigkrkgtknartnqktlwikrqrvlrrllkrlrdskkvdrhlyhs
    fylkckgnqfknkrtlieaiqreknetlkkkaiadqleakrlkaqvlrnkrklkkdkevv
    a
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vx7U (U:)
    mvkkidnslntnihqyhivgraiptakdknpnvyrmcifakndtnaksrfwyfmkkinkl
    kksngellaceqikerfplrvknygvllrydsrtgthnmykefrdttkegaiaqlysema
    grhrarassiniiriseissslvrrphikqllkrrlrfpalhlptlqkeyrkkfaskrps
    tyrm
    

    Sequence, based on observed residues (ATOM records):
    >1vx7U (U:)
    idnslntnihqyhivgraiptakdknpnvyrmcifakndtnaksrfwyfmkkinklkksn
    gellaceqikerfplrvknygvllrydsrtgthnmykefrdttkegaiaqlysemagrhr
    arassiniiriseissslvrrphikqllkrrlrfpalhlptlqkeyrkkfaskrpstyrm
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vx7V (V:)
    mggksrgkrsgtrykfskkfrkhgectankyleklnygdyvdivcdstqqkgmpfnyyhg
    ktgkifhitkrgvgvlvnkrvkhrieqkkvcvriehvrksrcnedfllrkiknaelikea
    klknehinikrktegpkpaamikvppskiitieplpfyeey
    

    Sequence, based on observed residues (ATOM records):
    >1vx7V (V:)
    ksrgkrsgtrykfskkfrkhgectankyleklnygdyvdivcdstqqkgmpfnyyhgktg
    kifhitkrgvgvlvnkrvkhrieqkkvcvriehvrksrcnedfllrkiknaelikeaklk
    nehinikrktegpkpaamikvppskiitieplpfy
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vx7W (W:)
    mvkyakkirnlgkcakgagvdlrvhfkntyeaarairrmklleakkylndviekkrcvpf
    rkynggvgrtnqakefnhtqgrwpaksckfllnildnvqanaesrnldvsklrlihvmvn
    karpgrrrtykahgrinpfmsspchiqiiareinkpakksllsnaekqkklpfkvtlkkl
    iklnisnqnrlknksvkkqqtvq
    

    Sequence, based on observed residues (ATOM records):
    >1vx7W (W:)
    yakkirnlgkcakgagvdlrvhfkntyeaarairrmklleakkylndviekkrcvpfrky
    nggvgrtnqakefnhtqgrwpaksckfllnildnvqanaesrnldvsklrlihvmvnkar
    pgrrrtykahgrinpfmsspchiqiiareinisnqnrlknksvkkqqtvq
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vx7X (X:)
    mvakkdstkvskklkkkvvkktkivkglkkqkmnkstkgikyvldctkpvkdtildisgl
    eqffkdkikvdkktnnlknkvvvtsdeykiyitvhipfskryikylakkyikmhqirdfl
    rviakgklayefkyfqlnn
    

    Sequence, based on observed residues (ATOM records):
    >1vx7X (X:)
    ikyvldctkpvkdtildisgleqffkdkikvdkktnnlknkvvvtsdeykiyitvhipfs
    kryikylakkyikmhqirdflrviakgklayefkyfq
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vx7Y (Y:)
    mtqvekkkknvknvnkhkiihkrvikkgnrkytngntkvkyrkqvvkktinknvskkkll
    kenvdkdekkkkmkisirfkkpktliyarnpkcprivkschsktldkyglikypltseka
    mkkieeintlvfmcdkrankknikksvknlfgiecdkvnvlntlngdkkayvrlsgehda
    levankigil
    

    Sequence, based on observed residues (ATOM records):
    >1vx7Y (Y:)
    arnpkcprivkschsktldkyglikypltsekamkkieeintlvfmcdkrankknikksv
    knlfgiecdkvnvlntlngdkkayvrlsgehdalevankig
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vx7Z (Z:)
    mkfnkqksssrrkmrkahftapaglrrkimssklskelrlkyktrslpvrkddevlicrg
    hnhgregkvvkinrkrykiyvervtrekvngestfigihpsnvvltklkvdknrkkildr
    kaaken
    

    Sequence, based on observed residues (ATOM records):
    >1vx7Z (Z:)
    kfnkqksssrrkmrkahftapaglrrkimssklskelrlkyktrslpvrkddevlicrgh
    nhgregkvvkinrkrykiyvervtrekvngestfigihpsnvvltklkvdknrkkildrk
    a
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >1vx7a (a:)
    maqrvhyrrhnhyntksnkvrpvrtpggkltihvvkkkagkpkcadcktaiqgvkalrpa
    dnyrarrknrtvarayggsicarcirerimraflfeeqkcvrqvlkekkkqekkvkkvkk
    ekkkvnakevkktatdnkkakkvadkkkgk
    

    Sequence, based on observed residues (ATOM records):
    >1vx7a (a:)
    aqrvhyrrhnhyntksnkvrpvrtpggkltihvvkkkagkpkcadcktaiqgvkalrpad
    nyrarrknrtvarayggsicarcirerimraflfeeqkcvrqvlke
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >1vx7b (b:)
    mgrkstikpatgiavgfnsghvvtkrnlklhkkkkpfskrkelikdvvreitgfspyekr
    iielikigtsastkrslkyakkklgthkrgkakreeiqkvvilqrrkaaekh
    

    Sequence, based on observed residues (ATOM records):
    >1vx7b (b:)
    grkstikpatgiavgfnsghvvtkrnskrkelikdvvreitgfspyekriielikigtsa
    stkrslkyakkklgthkrgkakreeiqkvvilqrr
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1vx7c (c:)
    mgkagkgtgsfgkrngkthflclrcgkrsyhlqkkkcascgypsakkrrfnwsvkakrrn
    ttgtgrcryiktlrrklknkftegstpkpkqr
    

    Sequence, based on observed residues (ATOM records):
    >1vx7c (c:)
    gkagkgtgsfgkrngkthflclrcgkrsyhlqkkkcascgypsakkrrfnwsvkakrrnt
    tgtgrcryiktlrrklknkftegstpkpk
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1vx7d (d:)
    mpkqitdirkflkisrkpdttaviimkkksktkkntvitklklrtkkylytmvfadrkka
    eriensllpslkriyypqkkvgktvkk
    

    Sequence, based on observed residues (ATOM records):
    >1vx7d (d:)
    pkqitdirkflkisrkpdttaviimkkksktvitklklrtkkylytmvfadrkkaerien
    sllpslkriyyp
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1vx7e (e:)
    mgsikrfrlkqrlgkcrrqnrpvphwyrlkkdtkiryntkrrhwrrtklgl
    

    Sequence, based on observed residues (ATOM records):
    >1vx7e (e:)
    gsikrfrlkqrlgkcrrqnrpvphwyrlkntkrrhwrrtklgl
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1vx7f (f:)
    mqifvktltgktitldvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggaiepslaqlaqkyncqklicrkcyarlhpratncrnkkcgrtnq
    lrpkkklk
    

    Sequence, based on observed residues (ATOM records):
    >1vx7f (f:)
    aiepslaqlaqkyncqklicrkcyarlhpratncrnkkcgrtnqlrpkkkl
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >1vx7g (g:)
    mahgasrykksrakmrwkwkkkrtrrlqkkrrkmrqrsr
    

    Sequence, based on observed residues (ATOM records):
    >1vx7g (g:)
    hgasrykksrakmrwkwkkkrtrrlqkkrrkmrqrsr
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1vx7h (h:)
    msrrtkkvgltgkygtrygsslrkqikkielmqhakylctfcgktatkrtcvgiwkckkc
    krkvcggawslttpaavaakstiirlrkqkeeaqks
    

    Sequence, based on observed residues (ATOM records):
    >1vx7h (h:)
    srrtkkvgltgkygtrygsslrkqikkielmqhakylctfcgktatkrtcvgiwkckkck
    rkvcggawslttpaavaakstiirl
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >1vx7i (i:)
    mvnvpktrktycsnkckkhtmhkvsqykkgkerlsslgrrrydmkqkgfggqtkpvfkkk
    akttkkivlklectkckkkrfqtmkrcktfemgadkkkkggavy
    

    Sequence, based on observed residues (ATOM records):
    >1vx7i (i:)
    vnvpktrktycsnkckkhtmhkvsqykkgkerlsslgrrrydmkqkgfggqtkpvfkkka
    kttkkivlklectkckkkrfqtmkrcktfemgadk