PDB entry 1vwk

View 1vwk on RCSB PDB site
Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2
Class: complex (biotin-binding protein/peptide)
Keywords: COMPLEX (BIOTIN-BINDING PROTEIN-PEPTIDE), LINEAR THIOETHER-CONTAINING PEPTIDE ENGINEERED, COMPLEX (BIOTIN-BINDING PROTEIN-PEPTIDE) complex
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.205
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vwkb_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vwkd_
  • Chain 'M':
    Compound: peptide ligand containing hpq
    Species: Bothrops insularis [TaxId:8723]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWK (0-End)
  • Chain 'P':
    Compound: peptide ligand containing hpq
    Species: Bothrops insularis [TaxId:8723]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWK (0-End)
  • Heterogens: LEA, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vwkB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vwkD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vwkD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v
    

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.