PDB entry 1vwe

View 1vwe on RCSB PDB site
Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 3.6
Class: complex (biotin-binding protein/peptide)
Keywords: complex (biotin-binding protein/peptide), cyclic peptide discovered by phage display
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vweb_
  • Chain 'P':
    Compound: peptide ligand containing hpq
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWE
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1vweB (B:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1vweB (B:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

  • Chain 'P':
    No sequence available.