PDB entry 1vwb

View 1vwb on RCSB PDB site
Description: streptavidin-cyclo-ac-[chpqfc]-nh2, ph 11.8
Class: complex (biotin-binding protein/peptide)
Keywords: complex (biotin-binding protein/peptide), cyclic peptide discovered by phage display
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOP 1.75 freeze date was dated 1998-03-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: streptavidin
  Species: Streptomyces avidinii
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22629 (0-122)
  Domains in SCOP 1.75: d1vwbb_
• Chain 'P':
  Compound: peptide ligand containing hpq
  
• Heterogens: ACE, NH2, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vwbB (B:)
  aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
  lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
  vkp
  

  
  
• Chain 'P':
  No sequence available.