PDB entry 1vwa

View 1vwa on RCSB PDB site
Description: streptavidin-fshpqnt
Class: complex (biotin-binding protein/peptide)
Keywords: COMPLEX (BIOTIN-BINDING PROTEIN-PEPTIDE), LINEAR PEPTIDE DISCOVERED BY PHAGE DISPLAY, COMPLEX (BIOTIN-BINDING PROTEIN-PEPTIDE) complex
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vwab_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vwad_
  • Chain 'M':
    Compound: peptide ligand containing hpq
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWA (Start-6)
  • Chain 'P':
    Compound: peptide ligand containing hpq
    Database cross-references and differences (RAF-indexed):
    • PDB 1VWA (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vwaB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vwaD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vwaD (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v
    

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.