PDB entry 1vw6

View 1vw6 on RCSB PDB site
Description: Computationally Designed Two-Component Self-Assembling Tetrahedral Cage T33-28
Deposited on 2013-12-06, released 2014-05-28
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.265
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain '1':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain '2':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain '3':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain '4':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain '5':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain '6':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain '7':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain '8':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain '9':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'A':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'B':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'C':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'D':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'E':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'F':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'G':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'H':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'I':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'J':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'K':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'L':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'M':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'N':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'O':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'P':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'Q':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'R':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'S':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'T':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'U':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'V':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'W':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'X':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'Y':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'Z':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'a':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'b':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'c':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'd':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'e':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'f':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'g':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'h':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'w':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'x':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'y':
    Compound: integron gene cassette protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'z':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence, based on SEQRES records:
    >1vw60 (0:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw60 (0:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain '1':
    Sequence, based on SEQRES records:
    >1vw61 (1:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw61 (1:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1vw62 (2:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw62 (2:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1vw63 (3:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw63 (3:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >1vw64 (4:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw64 (4:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >1vw65 (5:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw65 (5:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >1vw66 (6:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw66 (6:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >1vw67 (7:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw67 (7:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >1vw68 (8:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw68 (8:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehsc
    vtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain '9':
    Sequence, based on SEQRES records:
    >1vw69 (9:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw69 (9:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vw6A (A:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6A (A:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vw6B (B:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6B (B:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vw6C (C:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6C (C:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vw6D (D:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6D (D:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vw6E (E:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6E (E:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vw6F (F:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6F (F:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vw6G (G:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6G (G:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vw6H (H:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6H (H:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vw6I (I:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6I (I:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vw6J (J:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6J (J:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vw6K (K:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6K (K:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vw6L (L:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6L (L:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vw6M (M:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6M (M:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vw6N (N:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6N (N:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vw6O (O:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6O (O:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vw6P (P:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6P (P:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vw6Q (Q:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6Q (Q:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vw6R (R:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6R (R:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vw6S (S:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6S (S:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vw6T (T:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6T (T:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vw6U (U:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6U (U:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vw6V (V:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6V (V:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vw6W (W:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6W (W:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vw6X (X:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6X (X:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vw6Y (Y:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6Y (Y:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vw6Z (Z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6Z (Z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >1vw6a (a:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6a (a:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >1vw6b (b:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6b (b:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1vw6c (c:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6c (c:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1vw6d (d:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6d (d:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1vw6e (e:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6e (e:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1vw6f (f:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6f (f:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >1vw6g (g:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6g (g:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1vw6h (h:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6h (h:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'w':
    Sequence, based on SEQRES records:
    >1vw6w (w:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6w (w:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'x':
    Sequence, based on SEQRES records:
    >1vw6x (x:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6x (x:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'y':
    Sequence, based on SEQRES records:
    >1vw6y (y:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw6y (y:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdlivveretaeeeaklalrvalqvdiadehsc
    vtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'z':
    Sequence, based on SEQRES records:
    >1vw6z (z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw6z (z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf