PDB entry 1vw5

View 1vw5 on RCSB PDB site
Description: Computationally Designed Two-Component Self-Assembling Tetrahedral Cage T33-28
Deposited on 2013-12-06, released 2014-05-28
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.265
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'B':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'C':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'D':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'E':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (0-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'F':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'G':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'H':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'I':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'J':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'K':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'L':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'M':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'N':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'O':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'P':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'Q':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'R':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'S':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'T':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'U':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'V':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'W':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'X':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'Y':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'Z':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'a':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'b':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'c':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'd':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'e':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'f':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'g':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'h':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'i':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'j':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
      • expression tag (113)
  • Chain 'k':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'l':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'm':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'n':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'o':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'p':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'q':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'r':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 's':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 't':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)
  • Chain 'u':
    Compound: integron gene cassette protein
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BGB0 (Start-157)
      • engineered mutation (48)
      • engineered mutation (52)
      • engineered mutation (55-57)
      • engineered mutation (63)
      • engineered mutation (108)
      • engineered mutation (111-112)
      • engineered mutation (115)
  • Chain 'v':
    Compound: Macrophage migration inhibitory factor-like protein
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_33_1740, MIF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q413 (0-112)
      • engineered mutation (17-18)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (29)
      • engineered mutation (86-87)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vw5A (A:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5A (A:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vw5B (B:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5B (B:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vw5C (C:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5C (C:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vw5D (D:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5D (D:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vw5E (E:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5E (E:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiade
    hscvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vw5F (F:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5F (F:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vw5G (G:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5G (G:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vw5H (H:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5H (H:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vw5I (I:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5I (I:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1vw5J (J:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5J (J:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >1vw5K (K:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5K (K:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1vw5L (L:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5L (L:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >1vw5M (M:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5M (M:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vw5N (N:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5N (N:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >1vw5O (O:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5O (O:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >1vw5P (P:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5P (P:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >1vw5Q (Q:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5Q (Q:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >1vw5R (R:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5R (R:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vw5S (S:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5S (S:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vw5T (T:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5T (T:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vw5U (U:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5U (U:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >1vw5V (V:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5V (V:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >1vw5W (W:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5W (W:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vw5X (X:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5X (X:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vw5Y (Y:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5Y (Y:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vw5Z (Z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5Z (Z:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >1vw5a (a:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5a (a:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >1vw5b (b:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5b (b:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >1vw5c (c:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5c (c:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >1vw5d (d:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5d (d:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >1vw5e (e:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5e (e:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >1vw5f (f:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5f (f:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >1vw5g (g:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5g (g:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >1vw5h (h:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5h (h:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >1vw5i (i:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5i (i:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >1vw5j (j:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5j (j:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnfl
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >1vw5k (k:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5k (k:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >1vw5l (l:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5l (l:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >1vw5m (m:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5m (m:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >1vw5n (n:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5n (n:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >1vw5o (o:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5o (o:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >1vw5p (p:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5p (p:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >1vw5q (q:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5q (q:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >1vw5r (r:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5r (r:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >1vw5s (s:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5s (s:)
    svntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgddt
    edgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadehs
    cvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 't':
    Sequence, based on SEQRES records:
    >1vw5t (t:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5t (t:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf
    

  • Chain 'u':
    Sequence, based on SEQRES records:
    >1vw5u (u:)
    mesvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgd
    dtedgfkgphirircvdiddkhtynamvyvdlivgtgaseveretaeeeaklalrvalqv
    diadehscvtqfemklreellssdsfhpdkdeyykdfl
    

    Sequence, based on observed residues (ATOM records):
    >1vw5u (u:)
    esvntsflspslvtirdfdngqfavlrigrtgfpadkgdidlcldkmigvraaqiflgdd
    tedgfkgphirircvdiddkhtynamvyvdliveveretaeeeaklalrvalqvdiadeh
    scvtqfemklreellssdsfhpdkdeyykdfl
    

  • Chain 'v':
    Sequence, based on SEQRES records:
    >1vw5v (v:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnflehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >1vw5v (v:)
    mpviqtfvstpldhhkrlllaiiyrivtrvvlgkpedlvmmtfhdstpmhffgstdpvac
    vrvealggygpsepekvtsivtaaitavcgivadrifvlyfsplhcgwngtnf