PDB entry 1vw3

View 1vw3 on RCSB PDB site
Description: Structure of the yeast mitochondrial large ribosomal subunit
Deposited on 2014-01-22, released 2014-04-09
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 21S ribosomal RNA
    Species: Saccharomyces cerevisiae [TaxId:4932]
  • Chain 'B':
    Compound: 54S ribosomal protein RML2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 54S ribosomal protein L9, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 54S ribosomal protein YmL6, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, NA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vw3B (B:)
    mlvlgslrsalscsstasliskrnpcypygilcrtlsqsvklwqentskddsslnitprl
    lkiipndtdivtlekqdelikrrrklskevtqmkrlkpvspglrwyrspiypylykgrpv
    raltvvrkkhggrnnsgkitvrhqggghrnrtrlidfnrweggaqtvqrieydpgrsshi
    allkhnttgelsyiiacdglrpgdvvesfrrgipqtllnemggkvdpailsvkttqrgnc
    lpismipigtiihnvgitpvgpgkfcrsagtyarvlaklpekkkaivrlqsgehryvsle
    avatigvvsnidhqnrslgkagrsrwlgirptvrgvamnkcdhphgggrgksksnklsms
    pwgqlakgyktrrgknqnrmkvkdrprgkdarl
    

    Sequence, based on observed residues (ATOM records):
    >1vw3B (B:)
    likrrrklskevtqmkrlkpvspglrwyrspiypylykgrpvraltvvrkkhggrnnsgk
    itvrhqggghrnrtrlidfnrweggaqtvqrieydpgrsshiallkhnttgelsyiiacd
    glrpgdvvesfrrgiplsvkttqrgnclpismipigtiihnvgitpvgpgkfcrsagtya
    rvlaklpekkkaivrlqsgehryvsleavatigvvsnidhqnrslgkagrsrwlgirptv
    rgvamnkcdhphgggrgksksnklsmspwgqlakgyktrrgknqnrmkvkdrprg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vw3C (C:)
    mskflqgsifsisklhvrysstrpflvapsiansitteapainhspelanarkwlpkrcg
    litrkkgmmpyfdkstgersaatilevnnvevimhrtsevngyfacqvgygsrhlskvsr
    qmlghfaskvvnpkehvaefrvkdekglippgtllkpsffkegqyvdvrsvskgkgftgv
    mkrygfkglrashgtsimhrhggsygqnqdpgrvlpgrkmpghmgnehvtiqnvkvlkvd
    dennviwvkgsvagpknsfvkiqdaikkt
    

    Sequence, based on observed residues (ATOM records):
    >1vw3C (C:)
    strpflvapsiansitteapainhspelanarkwlpkrcglitrkkgmmpyfdkstgers
    aatilevnnvevimhrtsevngyfacqvgygsrhlskvsrqmlghfaskvvnpkehvaef
    rvkdekglippgtllkpsffkegqyvdvrsvskgkgftgvmkrygfkglrashgtsimhr
    hggsygqnqdpgrvlpgrkmpghmgnehvtiqnvkvlkvddennviwvkgsvagpknsfv
    kiqdaikkt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vw3D (D:)
    mtikrnlvktlqsiryqattatahaestlnplpnaaippkyalvtvrsfpslepltfvpv
    ptstvaaplrrdilwravvyendnrrvgasnppgrsengfsrrklmpqkgsgrarvgdan
    sptrhnggralartapndyttelpskvysmafnnalshqyksgklfviggekvdlisptp
    eldlnrldlvntntvegkeifegevifrkfleefqlkgkrllfitdktreglikssdpyk
    qkvdviqkelvevndilraqavfielealeylamahqkeilhsvsn
    

    Sequence, based on observed residues (ATOM records):
    >1vw3D (D:)
    plpnaaippkyalvtvrsfpslepltfvpvptstvaaplrrdilwravvyendnrrvgas
    nppgrsengfsrrklmpqkgsgrarvgdansptrhnggralartapndyttelpskvysm
    afnnalshqyksgklfviggekvdlisptpeldlnrldlifegevifrkfleefqlkgkr
    llfitdktreglikssdpykqkvdviqkelvevndilraqavfielealeylamahqke