PDB entry 1vw1

View 1vw1 on RCSB PDB site
Description: Crystal Structure of TcdA1
Deposited on 2014-01-03, released 2014-02-26
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.244
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TcdA1
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: tcdA, tcdA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TcdA1
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: tcdA, tcdA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: TcdA1
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: tcdA, tcdA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: TcdA1
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: tcdA, tcdA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: TcdA1
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: tcdA, tcdA1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vw1A (A:)
    mnesvkeipdvlksqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnr
    lyearilkranpqlqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaaylt
    elyrearnlhasdsvyyldtrrpdlksmalsqqnmdielstlslsnelllesikteskle
    nytkvmemlstfrpsgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllgin
    asispelfnilteeitegnaeelykknfgniepaslampeylkryynlsdeelsqfigka
    snfgqqeysnnqlitpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfk
    nfynasylsiklndkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswa
    yaaakftveeynqysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfl
    tkyymqryaihaetalilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlns
    gstgdwrktilkrafniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihql
    tideldllliavgegktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsyn
    ktltpeiknlldtvyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqp
    gdgamtaekfwdwlntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfv
    tkpemfgaatgaapahdalslimltrfadwvnalgekassvlaafeansltaeqladamn
    ldanlllqasiqaqnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgl
    dyiqsmketptyaqwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaa
    iksrddlyqyllidnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffid
    wdkynkrystwagvsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafms
    yltsfeqvanlkvisayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaana
    wsewhkidcpinpykstirpviyksrlyllwleqkeitkqtgnskdgyqtetdyryelkl
    ahirydgtwntpitfdvnkkiselkleknrapglycagyqgedtllvmfynqqdtldsyk
    nasmqglyifadmaskdmtpeqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrk
    dygwgdyylsmvyngdiptinykaassdlkiyispklriihngyegqkrnqcnlmnkygk
    lgdkfivytslgvnpnnssnklmfypvyqysgntsglnqgrllfhrdttypskveawipg
    akrsltnqnaaigddyatdslnkpddlkqyifmtdskgtatdvsgpveintaispakvqi
    ivkaggkeqtftadkdvsiqpspsfdemnyqfnaleidgsglnfinnsasidvtftafae
    dgrklgyesfsipvtlkvstdnaltlhhnengaqymqwqsyrtrlntlfarqlvarattg
    idtilsmetqniqepqlgkgfyatfvippynlsthgderwfklyikhvvdnnshiiysgq
    ltdtninitlfiplddvplnqdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksi
    lthfesvnvlnnissepmdfsganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvw
    spsgyivhgqiqnyqwnvrplledtswnsdpldsvdpdavaqhdpmhykvstfmrtldll
    iargdhayrqlerdtlneakmwymqalhllgdkpylplsttwsdprldraadittqnahd
    saivalrqniptpaplslrsantltdlflpqinevmmnywqtlaqrvynlrhnlsidgqp
    lylpiyatpadpkallsaavatsqgggklpesfmslwrfphmlenargmvsqltqfgstl
    qniierqdaealnallqnqaaeliltnlsiqdktieeldaektvlekskagaqsrfdsyg
    klydeninagenqamtlrasaaglttavqasrlagaaadlvpnifgfagggsrwgaiaea
    tgyvmefsanvmnteadkisqsetyrrrrqeweiqrnnaeaelkqidaqlkslavrreaa
    vlqktslktqqeqtqsqlaflqrkfsnqalynwlrgrlaaiyfqfydlavarclmaeqay
    rwelnddsarfikpgawqgtyagllagetlmlslaqmedahlkrdkralevertvslaev
    yaglpkdngpfslaqeidklvsqgsgsagsgnnnlafgagtdtktslqasvsfadlkire
    dypaslgkirrikqisvtlpallgpyqdvqailsygdkaglangcealavshgmndsgqf
    qldfndgkflpfegiaidqgtltlsfpnasmpekgkqatmlktlndiilhirytik
    

    Sequence, based on observed residues (ATOM records):
    >1vw1A (A:)
    sqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnrlyearilkranpq
    lqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaayltelyrearnlhasd
    svyyldtrrpdlksmalsqqnmdielstlslsnelllesiktesklenytkvmemlstfr
    psgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllginasispelfnilte
    eitegnaeelykknfgniepaslampeylkryynlsdeelsqfigkasnfgqqeysnnql
    itpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfknfynasylsikln
    dkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswayaaakftveeynq
    ysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfltkyymqryaihae
    talilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlnsgstgdwrktilkr
    afniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihqltideldllliavg
    egktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsynktltpeiknlldt
    vyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqpgdgamtaekfwdw
    lntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfvtkpemfgaatgaa
    pahdalslimltrfadwvnalgekassvlaafeansltaeqladamnldanlllqasiqa
    qnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgldyiqsmketptya
    qwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaaiksrddlyqylli
    dnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffidwdkynkrystwag
    vsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafmsyltsfeqvanlkv
    isayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaanawsewhkidcpinp
    ykstirpviyksrlyllwleqkeitkqyqtetdyryelklahirydgtwntpitfdvnkk
    iselkleknrapglycagyqgedtllvmfynqqdtldsyknasmqglyifadmaskdmtp
    eqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrkdygwgdyylsmvyngdipti
    nykaassdlkiyispklriihngyegqkrnqcnlmnkygklgdkfivytslgvnpnnssn
    klmfypvyqysgntsglnqgrllfhrdttypskveawipgakrsltnqnaaigddyatds
    lnkpddlkqyifmtdskgtatdvsgpveintaispakvqiivkaggkeqtftadkdvsiq
    pspsfdemnyqfnaleidgsglnfinnsasidvtftafaedgrklgyesfsipvtlkvst
    dnaltlhhnengaqymqwqsyrtrlntlfarqlvarattgidtilsmetqniqepqlgkg
    fyatfvippynlsthgderwfklyikhvvdnnshiiysgqltdtninitlfiplddvpln
    qdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksilthfesvnvlnnissepmdf
    sganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvwspsgyivhgqiqnyqwnvrp
    lledtswnsdpldsvdpdavaqhdpmhykvstfmrtldlliargdhayrqlerdtlneak
    mwymqalhllgdkpylplsttwsdprldraadittqnahdsaivalrqniptrsantltd
    lflpqinevmmnywqtlaqrvynlrhnlsidgqplylpiyatpadpkallsaavatsqgg
    gklpesfmslwrfphmlenargmvsqltqfgstlqniierqdaealnallqnqaaelilt
    nlsiqdktieeldaektvlekskagaqsrfdsygklydeninagenqamtlrasaagltt
    avqasrlagaaadlvpnifgfagggsrwgaiaeatgyvmefsanvmnteadkisqsetyr
    rrrqeweiqrnnaeaelkqidaqlkslavrreaavlqktslktqqeqtqsqlaflqrkfs
    nqalynwlrgrlaaiyfqfydlavarclmaeqayrwelnddsarfikpgawqgtyaglla
    getlmlslaqmedahlkrdkralevertvslaevyaglpkdngpfslaqeidklvsqgsg
    sagsgnnnlafgagtdtktslqasvsfadlkiredypaslgkirrikqisvtlpallgpy
    qdvqailsygdkaglangcealavshgmndsgqfqldfndgkflpfegiaidqgtltlsf
    pnasmpekgkqatmlktlndiilhirytik
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vw1B (B:)
    mnesvkeipdvlksqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnr
    lyearilkranpqlqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaaylt
    elyrearnlhasdsvyyldtrrpdlksmalsqqnmdielstlslsnelllesikteskle
    nytkvmemlstfrpsgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllgin
    asispelfnilteeitegnaeelykknfgniepaslampeylkryynlsdeelsqfigka
    snfgqqeysnnqlitpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfk
    nfynasylsiklndkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswa
    yaaakftveeynqysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfl
    tkyymqryaihaetalilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlns
    gstgdwrktilkrafniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihql
    tideldllliavgegktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsyn
    ktltpeiknlldtvyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqp
    gdgamtaekfwdwlntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfv
    tkpemfgaatgaapahdalslimltrfadwvnalgekassvlaafeansltaeqladamn
    ldanlllqasiqaqnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgl
    dyiqsmketptyaqwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaa
    iksrddlyqyllidnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffid
    wdkynkrystwagvsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafms
    yltsfeqvanlkvisayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaana
    wsewhkidcpinpykstirpviyksrlyllwleqkeitkqtgnskdgyqtetdyryelkl
    ahirydgtwntpitfdvnkkiselkleknrapglycagyqgedtllvmfynqqdtldsyk
    nasmqglyifadmaskdmtpeqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrk
    dygwgdyylsmvyngdiptinykaassdlkiyispklriihngyegqkrnqcnlmnkygk
    lgdkfivytslgvnpnnssnklmfypvyqysgntsglnqgrllfhrdttypskveawipg
    akrsltnqnaaigddyatdslnkpddlkqyifmtdskgtatdvsgpveintaispakvqi
    ivkaggkeqtftadkdvsiqpspsfdemnyqfnaleidgsglnfinnsasidvtftafae
    dgrklgyesfsipvtlkvstdnaltlhhnengaqymqwqsyrtrlntlfarqlvarattg
    idtilsmetqniqepqlgkgfyatfvippynlsthgderwfklyikhvvdnnshiiysgq
    ltdtninitlfiplddvplnqdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksi
    lthfesvnvlnnissepmdfsganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvw
    spsgyivhgqiqnyqwnvrplledtswnsdpldsvdpdavaqhdpmhykvstfmrtldll
    iargdhayrqlerdtlneakmwymqalhllgdkpylplsttwsdprldraadittqnahd
    saivalrqniptpaplslrsantltdlflpqinevmmnywqtlaqrvynlrhnlsidgqp
    lylpiyatpadpkallsaavatsqgggklpesfmslwrfphmlenargmvsqltqfgstl
    qniierqdaealnallqnqaaeliltnlsiqdktieeldaektvlekskagaqsrfdsyg
    klydeninagenqamtlrasaaglttavqasrlagaaadlvpnifgfagggsrwgaiaea
    tgyvmefsanvmnteadkisqsetyrrrrqeweiqrnnaeaelkqidaqlkslavrreaa
    vlqktslktqqeqtqsqlaflqrkfsnqalynwlrgrlaaiyfqfydlavarclmaeqay
    rwelnddsarfikpgawqgtyagllagetlmlslaqmedahlkrdkralevertvslaev
    yaglpkdngpfslaqeidklvsqgsgsagsgnnnlafgagtdtktslqasvsfadlkire
    dypaslgkirrikqisvtlpallgpyqdvqailsygdkaglangcealavshgmndsgqf
    qldfndgkflpfegiaidqgtltlsfpnasmpekgkqatmlktlndiilhirytik
    

    Sequence, based on observed residues (ATOM records):
    >1vw1B (B:)
    sqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnrlyearilkranpq
    lqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaayltelyrearnlhasd
    svyyldtrrpdlksmalsqqnmdielstlslsnelllesiktesklenytkvmemlstfr
    psgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllginasispelfnilte
    eitegnaeelykknfgniepaslampeylkryynlsdeelsqfigkasnfgqqeysnnql
    itpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfknfynasylsikln
    dkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswayaaakftveeynq
    ysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfltkyymqryaihae
    talilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlnsgstgdwrktilkr
    afniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihqltideldllliavg
    egktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsynktltpeiknlldt
    vyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqpgdgamtaekfwdw
    lntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfvtkpemfgaatgaa
    pahdalslimltrfadwvnalgekassvlaafeansltaeqladamnldanlllqasiqa
    qnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgldyiqsmketptya
    qwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaaiksrddlyqylli
    dnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffidwdkynkrystwag
    vsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafmsyltsfeqvanlkv
    isayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaanawsewhkidcpinp
    ykstirpviyksrlyllwleqkeitkqyqtetdyryelklahirydgtwntpitfdvnkk
    iselkleknrapglycagyqgedtllvmfynqqdtldsyknasmqglyifadmaskdmtp
    eqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrkdygwgdyylsmvyngdipti
    nykaassdlkiyispklriihngyegqkrnqcnlmnkygklgdkfivytslgvnpnnssn
    klmfypvyqysgntsglnqgrllfhrdttypskveawipgakrsltnqnaaigddyatds
    lnkpddlkqyifmtdskgtatdvsgpveintaispakvqiivkaggkeqtftadkdvsiq
    pspsfdemnyqfnaleidgsglnfinnsasidvtftafaedgrklgyesfsipvtlkvst
    dnaltlhhnengaqymqwqsyrtrlntlfarqlvarattgidtilsmetqniqepqlgkg
    fyatfvippynlsthgderwfklyikhvvdnnshiiysgqltdtninitlfiplddvpln
    qdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksilthfesvnvlnnissepmdf
    sganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvwspsgyivhgqiqnyqwnvrp
    lledtswnsdpldsvdpdavaqhdpmhykvstfmrtldlliargdhayrqlerdtlneak
    mwymqalhllgdkpylplsttwsdprldraadittqnahdsaivalrqniptrsantltd
    lflpqinevmmnywqtlaqrvynlrhnlsidgqplylpiyatpadpkallsaavatsqgg
    gklpesfmslwrfphmlenargmvsqltqfgstlqniierqdaealnallqnqaaelilt
    nlsiqdktieeldaektvlekskagaqsrfdsygklydeninagenqamtlrasaagltt
    avqasrlagaaadlvpnifgfagggsrwgaiaeatgyvmefsanvmnteadkisqsetyr
    rrrqeweiqrnnaeaelkqidaqlkslavrreaavlqktslktqqeqtqsqlaflqrkfs
    nqalynwlrgrlaaiyfqfydlavarclmaeqayrwelnddsarfikpgawqgtyaglla
    getlmlslaqmedahlkrdkralevertvslaevyaglpkdngpfslaqeidklvsqgsg
    sagsgnnnlafgagtdtktslqasvsfadlkiredypaslgkirrikqisvtlpallgpy
    qdvqailsygdkaglangcealavshgmndsgqfqldfndgkflpfegiaidqgtltlsf
    pnasmpekgkqatmlktlndiilhirytik
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1vw1C (C:)
    mnesvkeipdvlksqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnr
    lyearilkranpqlqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaaylt
    elyrearnlhasdsvyyldtrrpdlksmalsqqnmdielstlslsnelllesikteskle
    nytkvmemlstfrpsgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllgin
    asispelfnilteeitegnaeelykknfgniepaslampeylkryynlsdeelsqfigka
    snfgqqeysnnqlitpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfk
    nfynasylsiklndkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswa
    yaaakftveeynqysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfl
    tkyymqryaihaetalilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlns
    gstgdwrktilkrafniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihql
    tideldllliavgegktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsyn
    ktltpeiknlldtvyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqp
    gdgamtaekfwdwlntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfv
    tkpemfgaatgaapahdalslimltrfadwvnalgekassvlaafeansltaeqladamn
    ldanlllqasiqaqnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgl
    dyiqsmketptyaqwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaa
    iksrddlyqyllidnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffid
    wdkynkrystwagvsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafms
    yltsfeqvanlkvisayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaana
    wsewhkidcpinpykstirpviyksrlyllwleqkeitkqtgnskdgyqtetdyryelkl
    ahirydgtwntpitfdvnkkiselkleknrapglycagyqgedtllvmfynqqdtldsyk
    nasmqglyifadmaskdmtpeqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrk
    dygwgdyylsmvyngdiptinykaassdlkiyispklriihngyegqkrnqcnlmnkygk
    lgdkfivytslgvnpnnssnklmfypvyqysgntsglnqgrllfhrdttypskveawipg
    akrsltnqnaaigddyatdslnkpddlkqyifmtdskgtatdvsgpveintaispakvqi
    ivkaggkeqtftadkdvsiqpspsfdemnyqfnaleidgsglnfinnsasidvtftafae
    dgrklgyesfsipvtlkvstdnaltlhhnengaqymqwqsyrtrlntlfarqlvarattg
    idtilsmetqniqepqlgkgfyatfvippynlsthgderwfklyikhvvdnnshiiysgq
    ltdtninitlfiplddvplnqdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksi
    lthfesvnvlnnissepmdfsganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvw
    spsgyivhgqiqnyqwnvrplledtswnsdpldsvdpdavaqhdpmhykvstfmrtldll
    iargdhayrqlerdtlneakmwymqalhllgdkpylplsttwsdprldraadittqnahd
    saivalrqniptpaplslrsantltdlflpqinevmmnywqtlaqrvynlrhnlsidgqp
    lylpiyatpadpkallsaavatsqgggklpesfmslwrfphmlenargmvsqltqfgstl
    qniierqdaealnallqnqaaeliltnlsiqdktieeldaektvlekskagaqsrfdsyg
    klydeninagenqamtlrasaaglttavqasrlagaaadlvpnifgfagggsrwgaiaea
    tgyvmefsanvmnteadkisqsetyrrrrqeweiqrnnaeaelkqidaqlkslavrreaa
    vlqktslktqqeqtqsqlaflqrkfsnqalynwlrgrlaaiyfqfydlavarclmaeqay
    rwelnddsarfikpgawqgtyagllagetlmlslaqmedahlkrdkralevertvslaev
    yaglpkdngpfslaqeidklvsqgsgsagsgnnnlafgagtdtktslqasvsfadlkire
    dypaslgkirrikqisvtlpallgpyqdvqailsygdkaglangcealavshgmndsgqf
    qldfndgkflpfegiaidqgtltlsfpnasmpekgkqatmlktlndiilhirytik
    

    Sequence, based on observed residues (ATOM records):
    >1vw1C (C:)
    sqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnrlyearilkranpq
    lqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaayltelyrearnlhasd
    svyyldtrrpdlksmalsqqnmdielstlslsnelllesiktesklenytkvmemlstfr
    psgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllginasispelfnilte
    eitegnaeelykknfgniepaslampeylkryynlsdeelsqfigkasnfgqqeysnnql
    itpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfknfynasylsikln
    dkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswayaaakftveeynq
    ysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfltkyymqryaihae
    talilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlnsgstgdwrktilkr
    afniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihqltideldllliavg
    egktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsynktltpeiknlldt
    vyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqpgdgamtaekfwdw
    lntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfvtkpemfgaatgaa
    pahdalslimltrfadwvnalgekassvlaafeansltaeqladamnldanlllqasiqa
    qnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgldyiqsmketptya
    qwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaaiksrddlyqylli
    dnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffidwdkynkrystwag
    vsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafmsyltsfeqvanlkv
    isayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaanawsewhkidcpinp
    ykstirpviyksrlyllwleqkeitkqyqtetdyryelklahirydgtwntpitfdvnkk
    iselkleknrapglycagyqgedtllvmfynqqdtldsyknasmqglyifadmaskdmtp
    eqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrkdygwgdyylsmvyngdipti
    nykaassdlkiyispklriihngyegqkrnqcnlmnkygklgdkfivytslgvnpnnssn
    klmfypvyqysgntsglnqgrllfhrdttypskveawipgakrsltnqnaaigddyatds
    lnkpddlkqyifmtdskgtatdvsgpveintaispakvqiivkaggkeqtftadkdvsiq
    pspsfdemnyqfnaleidgsglnfinnsasidvtftafaedgrklgyesfsipvtlkvst
    dnaltlhhnengaqymqwqsyrtrlntlfarqlvarattgidtilsmetqniqepqlgkg
    fyatfvippynlsthgderwfklyikhvvdnnshiiysgqltdtninitlfiplddvpln
    qdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksilthfesvnvlnnissepmdf
    sganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvwspsgyivhgqiqnyqwnvrp
    lledtswnsdpldsvdpdavaqhdpmhykvstfmrtldlliargdhayrqlerdtlneak
    mwymqalhllgdkpylplsttwsdprldraadittqnahdsaivalrqniptrsantltd
    lflpqinevmmnywqtlaqrvynlrhnlsidgqplylpiyatpadpkallsaavatsqgg
    gklpesfmslwrfphmlenargmvsqltqfgstlqniierqdaealnallqnqaaelilt
    nlsiqdktieeldaektvlekskagaqsrfdsygklydeninagenqamtlrasaagltt
    avqasrlagaaadlvpnifgfagggsrwgaiaeatgyvmefsanvmnteadkisqsetyr
    rrrqeweiqrnnaeaelkqidaqlkslavrreaavlqktslktqqeqtqsqlaflqrkfs
    nqalynwlrgrlaaiyfqfydlavarclmaeqayrwelnddsarfikpgawqgtyaglla
    getlmlslaqmedahlkrdkralevertvslaevyaglpkdngpfslaqeidklvsqgsg
    sagsgnnnlafgagtdtktslqasvsfadlkiredypaslgkirrikqisvtlpallgpy
    qdvqailsygdkaglangcealavshgmndsgqfqldfndgkflpfegiaidqgtltlsf
    pnasmpekgkqatmlktlndiilhirytik
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vw1D (D:)
    mnesvkeipdvlksqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnr
    lyearilkranpqlqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaaylt
    elyrearnlhasdsvyyldtrrpdlksmalsqqnmdielstlslsnelllesikteskle
    nytkvmemlstfrpsgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllgin
    asispelfnilteeitegnaeelykknfgniepaslampeylkryynlsdeelsqfigka
    snfgqqeysnnqlitpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfk
    nfynasylsiklndkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswa
    yaaakftveeynqysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfl
    tkyymqryaihaetalilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlns
    gstgdwrktilkrafniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihql
    tideldllliavgegktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsyn
    ktltpeiknlldtvyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqp
    gdgamtaekfwdwlntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfv
    tkpemfgaatgaapahdalslimltrfadwvnalgekassvlaafeansltaeqladamn
    ldanlllqasiqaqnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgl
    dyiqsmketptyaqwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaa
    iksrddlyqyllidnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffid
    wdkynkrystwagvsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafms
    yltsfeqvanlkvisayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaana
    wsewhkidcpinpykstirpviyksrlyllwleqkeitkqtgnskdgyqtetdyryelkl
    ahirydgtwntpitfdvnkkiselkleknrapglycagyqgedtllvmfynqqdtldsyk
    nasmqglyifadmaskdmtpeqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrk
    dygwgdyylsmvyngdiptinykaassdlkiyispklriihngyegqkrnqcnlmnkygk
    lgdkfivytslgvnpnnssnklmfypvyqysgntsglnqgrllfhrdttypskveawipg
    akrsltnqnaaigddyatdslnkpddlkqyifmtdskgtatdvsgpveintaispakvqi
    ivkaggkeqtftadkdvsiqpspsfdemnyqfnaleidgsglnfinnsasidvtftafae
    dgrklgyesfsipvtlkvstdnaltlhhnengaqymqwqsyrtrlntlfarqlvarattg
    idtilsmetqniqepqlgkgfyatfvippynlsthgderwfklyikhvvdnnshiiysgq
    ltdtninitlfiplddvplnqdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksi
    lthfesvnvlnnissepmdfsganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvw
    spsgyivhgqiqnyqwnvrplledtswnsdpldsvdpdavaqhdpmhykvstfmrtldll
    iargdhayrqlerdtlneakmwymqalhllgdkpylplsttwsdprldraadittqnahd
    saivalrqniptpaplslrsantltdlflpqinevmmnywqtlaqrvynlrhnlsidgqp
    lylpiyatpadpkallsaavatsqgggklpesfmslwrfphmlenargmvsqltqfgstl
    qniierqdaealnallqnqaaeliltnlsiqdktieeldaektvlekskagaqsrfdsyg
    klydeninagenqamtlrasaaglttavqasrlagaaadlvpnifgfagggsrwgaiaea
    tgyvmefsanvmnteadkisqsetyrrrrqeweiqrnnaeaelkqidaqlkslavrreaa
    vlqktslktqqeqtqsqlaflqrkfsnqalynwlrgrlaaiyfqfydlavarclmaeqay
    rwelnddsarfikpgawqgtyagllagetlmlslaqmedahlkrdkralevertvslaev
    yaglpkdngpfslaqeidklvsqgsgsagsgnnnlafgagtdtktslqasvsfadlkire
    dypaslgkirrikqisvtlpallgpyqdvqailsygdkaglangcealavshgmndsgqf
    qldfndgkflpfegiaidqgtltlsfpnasmpekgkqatmlktlndiilhirytik
    

    Sequence, based on observed residues (ATOM records):
    >1vw1D (D:)
    sqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnrlyearilkranpq
    lqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaayltelyrearnlhasd
    svyyldtrrpdlksmalsqqnmdielstlslsnelllesiktesklenytkvmemlstfr
    psgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllginasispelfnilte
    eitegnaeelykknfgniepaslampeylkryynlsdeelsqfigkasnfgqqeysnnql
    itpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfknfynasylsikln
    dkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswayaaakftveeynq
    ysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfltkyymqryaihae
    talilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlnsgstgdwrktilkr
    afniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihqltideldllliavg
    egktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsynktltpeiknlldt
    vyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqpgdgamtaekfwdw
    lntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfvtkpemfgaatgaa
    pahdalslimltrfadwvnalgekassvlaafeansltaeqladamnldanlllqasiqa
    qnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgldyiqsmketptya
    qwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaaiksrddlyqylli
    dnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffidwdkynkrystwag
    vsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafmsyltsfeqvanlkv
    isayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaanawsewhkidcpinp
    ykstirpviyksrlyllwleqkeitkqyqtetdyryelklahirydgtwntpitfdvnkk
    iselkleknrapglycagyqgedtllvmfynqqdtldsyknasmqglyifadmaskdmtp
    eqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrkdygwgdyylsmvyngdipti
    nykaassdlkiyispklriihngyegqkrnqcnlmnkygklgdkfivytslgvnpnnssn
    klmfypvyqysgntsglnqgrllfhrdttypskveawipgakrsltnqnaaigddyatds
    lnkpddlkqyifmtdskgtatdvsgpveintaispakvqiivkaggkeqtftadkdvsiq
    pspsfdemnyqfnaleidgsglnfinnsasidvtftafaedgrklgyesfsipvtlkvst
    dnaltlhhnengaqymqwqsyrtrlntlfarqlvarattgidtilsmetqniqepqlgkg
    fyatfvippynlsthgderwfklyikhvvdnnshiiysgqltdtninitlfiplddvpln
    qdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksilthfesvnvlnnissepmdf
    sganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvwspsgyivhgqiqnyqwnvrp
    lledtswnsdpldsvdpdavaqhdpmhykvstfmrtldlliargdhayrqlerdtlneak
    mwymqalhllgdkpylplsttwsdprldraadittqnahdsaivalrqniptrsantltd
    lflpqinevmmnywqtlaqrvynlrhnlsidgqplylpiyatpadpkallsaavatsqgg
    gklpesfmslwrfphmlenargmvsqltqfgstlqniierqdaealnallqnqaaelilt
    nlsiqdktieeldaektvlekskagaqsrfdsygklydeninagenqamtlrasaagltt
    avqasrlagaaadlvpnifgfagggsrwgaiaeatgyvmefsanvmnteadkisqsetyr
    rrrqeweiqrnnaeaelkqidaqlkslavrreaavlqktslktqqeqtqsqlaflqrkfs
    nqalynwlrgrlaaiyfqfydlavarclmaeqayrwelnddsarfikpgawqgtyaglla
    getlmlslaqmedahlkrdkralevertvslaevyaglpkdngpfslaqeidklvsqgsg
    sagsgnnnlafgagtdtktslqasvsfadlkiredypaslgkirrikqisvtlpallgpy
    qdvqailsygdkaglangcealavshgmndsgqfqldfndgkflpfegiaidqgtltlsf
    pnasmpekgkqatmlktlndiilhirytik
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vw1E (E:)
    mnesvkeipdvlksqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnr
    lyearilkranpqlqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaaylt
    elyrearnlhasdsvyyldtrrpdlksmalsqqnmdielstlslsnelllesikteskle
    nytkvmemlstfrpsgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllgin
    asispelfnilteeitegnaeelykknfgniepaslampeylkryynlsdeelsqfigka
    snfgqqeysnnqlitpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfk
    nfynasylsiklndkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswa
    yaaakftveeynqysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfl
    tkyymqryaihaetalilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlns
    gstgdwrktilkrafniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihql
    tideldllliavgegktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsyn
    ktltpeiknlldtvyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqp
    gdgamtaekfwdwlntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfv
    tkpemfgaatgaapahdalslimltrfadwvnalgekassvlaafeansltaeqladamn
    ldanlllqasiqaqnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgl
    dyiqsmketptyaqwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaa
    iksrddlyqyllidnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffid
    wdkynkrystwagvsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafms
    yltsfeqvanlkvisayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaana
    wsewhkidcpinpykstirpviyksrlyllwleqkeitkqtgnskdgyqtetdyryelkl
    ahirydgtwntpitfdvnkkiselkleknrapglycagyqgedtllvmfynqqdtldsyk
    nasmqglyifadmaskdmtpeqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrk
    dygwgdyylsmvyngdiptinykaassdlkiyispklriihngyegqkrnqcnlmnkygk
    lgdkfivytslgvnpnnssnklmfypvyqysgntsglnqgrllfhrdttypskveawipg
    akrsltnqnaaigddyatdslnkpddlkqyifmtdskgtatdvsgpveintaispakvqi
    ivkaggkeqtftadkdvsiqpspsfdemnyqfnaleidgsglnfinnsasidvtftafae
    dgrklgyesfsipvtlkvstdnaltlhhnengaqymqwqsyrtrlntlfarqlvarattg
    idtilsmetqniqepqlgkgfyatfvippynlsthgderwfklyikhvvdnnshiiysgq
    ltdtninitlfiplddvplnqdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksi
    lthfesvnvlnnissepmdfsganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvw
    spsgyivhgqiqnyqwnvrplledtswnsdpldsvdpdavaqhdpmhykvstfmrtldll
    iargdhayrqlerdtlneakmwymqalhllgdkpylplsttwsdprldraadittqnahd
    saivalrqniptpaplslrsantltdlflpqinevmmnywqtlaqrvynlrhnlsidgqp
    lylpiyatpadpkallsaavatsqgggklpesfmslwrfphmlenargmvsqltqfgstl
    qniierqdaealnallqnqaaeliltnlsiqdktieeldaektvlekskagaqsrfdsyg
    klydeninagenqamtlrasaaglttavqasrlagaaadlvpnifgfagggsrwgaiaea
    tgyvmefsanvmnteadkisqsetyrrrrqeweiqrnnaeaelkqidaqlkslavrreaa
    vlqktslktqqeqtqsqlaflqrkfsnqalynwlrgrlaaiyfqfydlavarclmaeqay
    rwelnddsarfikpgawqgtyagllagetlmlslaqmedahlkrdkralevertvslaev
    yaglpkdngpfslaqeidklvsqgsgsagsgnnnlafgagtdtktslqasvsfadlkire
    dypaslgkirrikqisvtlpallgpyqdvqailsygdkaglangcealavshgmndsgqf
    qldfndgkflpfegiaidqgtltlsfpnasmpekgkqatmlktlndiilhirytik
    

    Sequence, based on observed residues (ATOM records):
    >1vw1E (E:)
    sqcgfncltdishssfnefrqqvsehlswsethdlyhdaqqaqkdnrlyearilkranpq
    lqnavhlailapnaeligynnqfsgrasqyvapgtvssmfspaayltelyrearnlhasd
    svyyldtrrpdlksmalsqqnmdielstlslsnelllesiktesklenytkvmemlstfr
    psgatpyhdayenvreviqlqdpgleqlnaspaiaglmhqasllginasispelfnilte
    eitegnaeelykknfgniepaslampeylkryynlsdeelsqfigkasnfgqqeysnnql
    itpvvnssdgtvkvyritreyttnayqmdvelfpfggenyrldykfknfynasylsikln
    dkrelvrtegapqvnieysanitlntadisqpfeigltrvlpsgswayaaakftveeynq
    ysfllklnkairlsratelsptilegivrsvnlqldintdvlgkvfltkyymqryaihae
    talilcnapisqrsydnqpsqfdrlfntpllngqyfstgdeeidlnsgstgdwrktilkr
    afniddvslfrllkitdhdnkdgkiknnlknlsnlyigklladihqltideldllliavg
    egktnlsaisdkqlatlirklntitswlhtqkwsvfqlfimtstsynktltpeiknlldt
    vyhglqgfdkdkadllhvmapyiaatlqlssenvahsvllwadklqpgdgamtaekfwdw
    lntkytpgsseavetqehivqycqalaqlemvyhstginenafrlfvtkpemfgaatgaa
    pahdalslimltrfadwvnalgekassvlaafeansltaeqladamnldanlllqasiqa
    qnhqhlppvtpenafscwtsintilqwvnvaqqlnvapqgvsalvgldyiqsmketptya
    qwenaagvltaglnsqqantlhafldesrsaalstyyirqvakaaaaiksrddlyqylli
    dnqvsaaikttriaeaiasiqlyvnralenveenansgvisrqffidwdkynkrystwag
    vsqlvyypenyidptmrigqtkmmdallqsvsqsqlnadtvedafmsyltsfeqvanlkv
    isayhdninndqgltyfiglsetdageyywrsvdhskfndgkfaanawsewhkidcpinp
    ykstirpviyksrlyllwleqkeitkqyqtetdyryelklahirydgtwntpitfdvnkk
    iselkleknrapglycagyqgedtllvmfynqqdtldsyknasmqglyifadmaskdmtp
    eqsnvyrdnsyqqfdtnnvrrvnnryaedyeipssvssrkdygwgdyylsmvyngdipti
    nykaassdlkiyispklriihngyegqkrnqcnlmnkygklgdkfivytslgvnpnnssn
    klmfypvyqysgntsglnqgrllfhrdttypskveawipgakrsltnqnaaigddyatds
    lnkpddlkqyifmtdskgtatdvsgpveintaispakvqiivkaggkeqtftadkdvsiq
    pspsfdemnyqfnaleidgsglnfinnsasidvtftafaedgrklgyesfsipvtlkvst
    dnaltlhhnengaqymqwqsyrtrlntlfarqlvarattgidtilsmetqniqepqlgkg
    fyatfvippynlsthgderwfklyikhvvdnnshiiysgqltdtninitlfiplddvpln
    qdyhakvymtfkkspsdgtwwgphfvrddkgivtinpksilthfesvnvlnnissepmdf
    sganslyfwelfyytpmlvaqrllheqnfdeanrwlkyvwspsgyivhgqiqnyqwnvrp
    lledtswnsdpldsvdpdavaqhdpmhykvstfmrtldlliargdhayrqlerdtlneak
    mwymqalhllgdkpylplsttwsdprldraadittqnahdsaivalrqniptrsantltd
    lflpqinevmmnywqtlaqrvynlrhnlsidgqplylpiyatpadpkallsaavatsqgg
    gklpesfmslwrfphmlenargmvsqltqfgstlqniierqdaealnallqnqaaelilt
    nlsiqdktieeldaektvlekskagaqsrfdsygklydeninagenqamtlrasaagltt
    avqasrlagaaadlvpnifgfagggsrwgaiaeatgyvmefsanvmnteadkisqsetyr
    rrrqeweiqrnnaeaelkqidaqlkslavrreaavlqktslktqqeqtqsqlaflqrkfs
    nqalynwlrgrlaaiyfqfydlavarclmaeqayrwelnddsarfikpgawqgtyaglla
    getlmlslaqmedahlkrdkralevertvslaevyaglpkdngpfslaqeidklvsqgsg
    sagsgnnnlafgagtdtktslqasvsfadlkiredypaslgkirrikqisvtlpallgpy
    qdvqailsygdkaglangcealavshgmndsgqfqldfndgkflpfegiaidqgtltlsf
    pnasmpekgkqatmlktlndiilhirytik