PDB entry 1vvs

View 1vvs on RCSB PDB site
Description: Crystal Structure of Frameshift Suppressor tRNA SufA6 Bound to Codon CCC-A on the Ribosome
Deposited on 2013-06-13, released 2014-08-06
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.237
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '1':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKU1 (Start-64)
    • PDB 1VVS (Start-64)
  • Chain '9':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80256 (0-36)
    • PDB 1VVS (0-36)
  • Chain 'A':
    Compound: 23s rRNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 5s rRNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: tRNA acceptor end mimic
    Species: synthetic, synthetic [TaxId:32630]
  • Heterogens: MG, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '0':
    Sequence, based on SEQRES records:
    >1vvs0 (0:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records):
    >1vvs0 (0:)
    ahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfa
    lvdgvvefqdrgrlgryvhvrp
    

  • Chain '1':
    Sequence, based on SEQRES records:
    >1vvs1 (1:)
    mskvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitf
    rvaashipkvyelverakglkleglspkeikkellkll
    

    Sequence, based on observed residues (ATOM records):
    >1vvs1 (1:)
    skvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfr
    vaashipkvyelverakglkleglspkeikkellkll
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1vvs2 (2:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    ltvlnekrrqna
    

    Sequence, based on observed residues (ATOM records):
    >1vvs2 (2:)
    sevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltv
    lnekrrqna
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >1vvs3 (3:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

    Sequence, based on observed residues (ATOM records):
    >1vvs3 (3:)
    prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records:
    >1vvs4 (4:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfvdtegrverfq
    rrygdsyrkgr
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >1vvs5 (5:)
    makhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
    

    Sequence, based on observed residues (ATOM records):
    >1vvs5 (5:)
    akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvle
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >1vvs6 (6:)
    masevriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

    Sequence, based on observed residues (ATOM records):
    >1vvs6 (6:)
    vriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records:
    >1vvs7 (7:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >1vvs8 (8:)
    mpkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikl
    llpye
    

    Sequence, based on observed residues (ATOM records):
    >1vvs8 (8:)
    pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
    lpye
    

  • Chain '9':
    Sequence; same for both SEQRES and ATOM records:
    >1vvs9 (9:)
    mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1vvsD (D:)
    mavkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkr
    lyriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvag
    pdapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsg
    elrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegra
    prgrppaspwgwqtkglktrkrrkpssrfiiarrkk
    

    Sequence, based on observed residues (ATOM records):
    >1vvsD (D:)
    avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
    yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
    dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
    lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
    rgrppaspwgwqtkglktrkrrkpssrfiiar
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1vvsE (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records):
    >1vvsE (E:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1vvsF (F:)
    mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
    grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
    gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
    lnvydivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records):
    >1vvsF (F:)
    vyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgrkiw
    pqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregklll
    veafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeglnvyd
    ivrterlvmdldawevfqnrig
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1vvsG (G:)
    mpldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqel
    alitgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgl
    npnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpf
    rk
    

    Sequence, based on observed residues (ATOM records):
    >1vvsG (G:)
    pldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqela
    litgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgln
    pnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfr
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1vvsH (H:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records):
    >1vvsH (H:)
    srigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrh
    kslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegi
    tfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrl
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >1vvsI (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

    Sequence, based on observed residues (ATOM records):
    >1vvsI (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvva
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >1vvsN (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records):
    >1vvsN (N:)
    mktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadki
    rvtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrl
    kvyagpdhphqaqrpekl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsO (O:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsP (P:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsQ (Q:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsR (R:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >1vvsS (S:)
    marltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkg
    nktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records):
    >1vvsS (S:)
    arltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgn
    ktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >1vvsT (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqkaqepkasqe
    

    Sequence, based on observed residues (ATOM records):
    >1vvsT (T:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idqdraaeraakeeaqk
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >1vvsU (U:)
    mpraktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrl
    wivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

    Sequence, based on observed residues (ATOM records):
    >1vvsU (U:)
    praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
    ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsV (V:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >1vvsW (W:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >1vvsX (X:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records):
    >1vvsX (X:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealeg
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >1vvsY (Y:)
    mrvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggf
    iekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records):
    >1vvsY (Y:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcg
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >1vvsZ (Z:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records):
    >1vvsZ (Z:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    ekl
    

  • Chain 'a':
    No sequence available.